KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1244Help
Entry
CJM1_1244         CDS       T01855                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
cjm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJM1_1244 (recR)
DNA repair and recombination proteins [BR:cjm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CJM1_1244 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CJM1_1244 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 Ras_bdg_2 zn-ribbon_14
Motif
Other DBs
NCBI-ProteinID: ADN91437
Position
1208891..1209463
Genome map
AA seq 190 aa AA seqDB search
MAKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCGQ
CGALSENELCEICSDEERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGVNLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggcctagaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgctataaggcttgcttatcatctttgcataaataatcaaatcgat
ggcatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgggcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgatgaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagcattaat
tctgatgcaactatcttttttatagaagataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtgtgaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system