KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1244Help
Entry
CJM1_1244         CDS       T01855                                 

Gene name
recR
Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cjm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1208891..1209463
Genome map
AA seq 190 aa AA seqDB search
MAKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCGQ
CGALSENELCEICSDEERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGVNLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggcctagaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgctataaggcttgcttatcatctttgcataaataatcaaatcgat
ggcatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgggcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgatgaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagcattaat
tctgatgcaactatcttttttatagaagataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtgtgaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system