KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1364Help
Entry
CJM1_1364         CDS       T01855                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CJM1_1364 (algC)
   00030 Pentose phosphate pathway
    CJM1_1364 (algC)
   00051 Fructose and mannose metabolism
    CJM1_1364 (algC)
   00052 Galactose metabolism
    CJM1_1364 (algC)
   00500 Starch and sucrose metabolism
    CJM1_1364 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    CJM1_1364 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    CJM1_1364 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CJM1_1364 (algC)
Enzymes [BR:cjm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     CJM1_1364 (algC)
    5.4.2.8  phosphomannomutase
     CJM1_1364 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1330109..1331479)
Genome map
AA seq 456 aa AA seqDB search
MLDVIFREYDIRGLYGKELNEKSVKAIGFCLGQTMLNKGCKNVSVGYDARYSANELFNYL
VSGLNKAGIKIYDIGLVPTPLGYFSLYEGLKFDANVMITGSHNPKDYNGFKITINKESFF
GEELKEFSKEVYKHLDDEIEENLEVEKYDILSLYVKFMCEQFSFLKDFNYKFGVDCTNGA
AGVVIKPLIKALNLKAHVMFAEPDGQFPNHAPDPTEEENLSAIREFLNQNQDYSLAFAFD
GDADRMVALSKTHVFCGDELCYLFAKNIPNPRILGEVKCSKNLFDEVAKFGTIFMGKTGH
SNIKKMMKEKDIDLAAEVSGHIFFKHRYFGYDDGIYAFLRALELVYKGFDLESMIKALPK
LYTTPEIKIHVNEEEKFKLVEEFQKEIEKGALKGVKSLCEIDGARIDFGDGWALLRASNT
SPYLITRFEATSLERAKELESTVFSLFNEIKARLKN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgtgatttttagagaatatgatataagaggactttatggcaaagaactgaat
gaaaaaagtgttaaggctataggtttttgcttgggacaaaccatgctaaataaaggctgt
aaaaatgtaagtgtgggctatgatgcaagatatagtgcaaatgaactttttaattatcta
gtgagtggacttaacaaagcgggaataaaaatctatgatatagggcttgtaccaactcca
ttgggatattttagtctttatgagggcttgaaatttgatgcaaatgttatgataacaggc
tctcataacccaaaagattataatggttttaaaatcactatcaataaagaaagttttttt
ggcgaggaattaaaagagttttcaaaagaagtttataagcatttggatgatgagattgaa
gaaaatttagaagtagaaaaatacgatattttaagcctttatgtgaagtttatgtgcgag
caatttagctttttaaaggattttaattataaatttggtgttgattgcacaaatggtgcg
gctggagtggtgataaagcctttaatcaaggctttaaatttaaaagctcatgtaatgttt
gcagagcctgatggacagtttccaaaccacgctccagatcctacagaagaagaaaactta
agtgcgattagagagtttttaaatcaaaatcaagattattctttagcttttgcttttgat
ggggatgctgatagaatggttgctttgagtaaaactcatgtattttgtggagatgagctt
tgttatttgtttgctaaaaatattcctaatccacgcattttaggtgaggtaaaatgttct
aaaaatctttttgatgaagtggctaaatttggaactatttttatgggaaaaacaggacat
tctaatatcaaaaaaatgatgaaagaaaaagatattgatttagctgctgaagtgagtggg
catattttctttaaacatagatattttggttatgatgatggaatttacgcatttttaaga
gccttagaacttgtttataaaggttttgatttagaaagtatgattaaagctttaccaaaa
ctctatactacacctgaaattaaaattcatgtaaatgaagaagaaaaatttaaacttgtg
gaagaatttcaaaaagagattgaaaaaggagctttaaaaggtgttaaaagtctttgtgaa
attgatggagctaggatagattttggcgatggatgggctttgcttcgtgcatctaacacc
agcccttatcttatcacacgctttgaagcaacttctttagaaagagcaaaagagcttgaa
agtacggtatttagtttgtttaatgagataaaagctaggcttaagaattga

DBGET integrated database retrieval system