KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1477Help
Entry
CJM1_1477         CDS       T01855                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CJM1_1477 (galU)
   00052 Galactose metabolism
    CJM1_1477 (galU)
   00500 Starch and sucrose metabolism
    CJM1_1477 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CJM1_1477 (galU)
Enzymes [BR:cjm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CJM1_1477 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1444979..1445803)
Genome map
AA seq 274 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMENMGFVTGRGKR
ALEDYFDISYELEHQISGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGKPLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVIFGNFVEE
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTKAGKNGEIQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFYEKSKC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtattttccctgcggcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaactaagcctttgatccattatggggtt
gatgaagctttggaagcaggaatggaaaatatgggctttgtcacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgagcatcaaatttcaggtacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgcacctttacttttaca
agacaaaatcaaatgaaaggattaggtgatgcggttttaaaaggtaaacctttggttggt
gatgaagcttttggcgtaattttggctgatgatttgtgtgtcaacgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagaacaagtttcaaactatggagtaatttttggaaattttgtagaagaa
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
aaagcgggaaaaaatggcgaaattcaacttaccgacgcgcttttaactcaagcaaccaat
ggtatggttttagcttataaatttcaagggaaacgctttgattgtggaagtgtagaaggc
tttgtagaggctacaaattatttttacgagaaaagtaaatgttaa

DBGET integrated database retrieval system