KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1624Help
Entry
CJM1_1624         CDS       T01855                                 

Gene name
cysQ
Definition
CysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cjm00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1574240..1575073)
Genome map
AA seq 277 aa AA seqDB search
MEIKNSTKSSCIILKNLIESLIIMLNLDKFLEIAINASNQASKAILEERKNFKTWEKEDK
SPLTSADLASNKILNDILGSTDIKILSEEKLLSKEECEELKTFWLIDPLDGTSGFLKGSD
EFCVMISLVHDNRPVLSLIQNPSKGDIFYAHAKTKVYKNDKPLQIDQQEYEKNKYKALLS
VNHLSKEDEDFAKEHQLEAINIGSGLKFCAILEARAGVYKRFEKLNIWDIVAGDFLINQN
GGFMGDFSKKYILYNPLNYKSSPFICVSSRNFLQDFL
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
gtggaaattaaaaattccacaaaatcttcttgtataattttaaaaaatcttatagaaagt
cttataatcatgcttaatcttgataaatttttagaaattgctataaatgctagcaatcaa
gcttctaaagctattttagaagagagaaaaaatttcaaaacttgggaaaaagaagataaa
agcccgcttacatcagcagatcttgcttctaataaaattctaaatgatattttaggttct
acggatattaaaattttatcagaagaaaaattactcagcaaagaagagtgtgaagaatta
aaaactttttggcttatcgatcctcttgatggaacaagtggttttttaaaaggcagcgat
gaattttgcgttatgataagtttagttcatgacaatcgccctgttttatcgcttatacaa
aatccatcaaaaggtgatatattctatgctcatgcaaaaaccaaggtttataaaaacgat
aaacctttgcaaattgaccagcaagaatacgagaaaaataaatataaagccttattgagt
gttaatcatcttagtaaagaagatgaagactttgcaaaagagcatcaattagaagctatt
aatataggctctggattgaaattttgtgctattttagaggctagggcaggagtttataaa
agatttgaaaagcttaatatttgggatattgtagcaggagattttttgattaatcaaaat
ggaggatttatgggggatttttctaaaaaatacattttatataaccctttaaattataaa
tccagtccttttatttgtgtttcatctaggaattttttacaagattttttataa

DBGET integrated database retrieval system