KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_1210Help
Entry
ICDCCJ_1210       CDS       T01372                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ICDCCJ_1210
DNA repair and recombination proteins [BR:cjn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      ICDCCJ_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234637..1235209
Genome map
AA seq 190 aa AA seqDB search
MVKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQ
CGALSENELCEICSDEERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGVNLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaggcctggaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgccataaggcttgcttatcacctttgcataaataatcaaatcgat
ggcatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgagcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgatgaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagcattaat
tctgatgcaactatcttttttatagaggataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtgtaaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system