KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_1332Help
Entry
ICDCCJ_1332       CDS       T01372                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ICDCCJ_1332
   01230 Biosynthesis of amino acids
    ICDCCJ_1332
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ICDCCJ_1332
   00051 Fructose and mannose metabolism
    ICDCCJ_1332
   00562 Inositol phosphate metabolism
    ICDCCJ_1332
Enzymes [BR:cjn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ICDCCJ_1332
Exosome [BR:cjn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ICDCCJ_1332
  Exosomal proteins of bladder cancer cells
   ICDCCJ_1332
  Exosomal proteins of melanoma cells
   ICDCCJ_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1365628..1366299)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAKILNKTMGVKCDDIIVFPPSIAFLENENNFIQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagagcaagctttaaaatttatgct
aaaattttaaataaaactatgggggtaaaatgtgatgatattatcgtttttccacctagt
atagcatttttagaaaatgaaaataacttcatacaaggagcgcaaaatttttatccttgt
gttaatggtgcttttacaggcgagcttggaaaagaacatttggacgaatttgggattaaa
tgtgtcttaatcgggcattctgaaagaagagctttaggagatgaagaatttattaaggct
aaatttgattttgctaaagagcatggttataaaattgttttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agcgcacaaagtacagatatcgctaaagtgcttgaatttttagcgagtttaaccaaagta
cctttgctttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system