KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_1360Help
Entry
ICDCCJ_1360       CDS       T01372                                 

Definition
dTDP-6-deoxy-D-xylo-4-hexulose-3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ICDCCJ_1360
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ICDCCJ_1360
Enzymes [BR:cjn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ICDCCJ_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1392831..1393376)
Genome map
AA seq 181 aa AA seqDB search
MAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTDEAINKLLPSGLKFIHDKFIHSKH
NVIRGIHGDVKTYKLATCVYGEIHQVVVDCRKDSPTYLKHERFIINQDNQQIILVPAGFG
NAHYVSSESAVYYYKCAYKGDYADAPDQFTYAWNDERIGIDWPTNSPILSERDILAMSKD
K
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcaatagaatttgatatacaagaatcaaaaattttaaaaggagtgtatattataact
cctaataaatttagagatttaagaggtgaaatttggacagcttttacagatgaagctata
aataagcttttgccaagtggactaaaatttatacatgataaatttatacattcaaagcat
aatgttattcgtggtattcatggtgatgtaaaaacttacaagcttgctacttgtgtttat
ggggaaattcatcaagttgtggttgattgcagaaaagattcaccaacttatttgaagcat
gaaagattcatcataaatcaagataatcagcaaatcattttagttccagcaggttttgga
aatgcacattatgttagtagtgaaagtgcagtttattattataaatgcgcatataaagga
gattatgcggatgcacctgatcaatttacttatgcatggaatgatgaaagaattggtata
gattggccaacaaattctcctatcctttcagagcgtgatattttagcgatgagcaaggat
aaatga

DBGET integrated database retrieval system