KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_1390Help
Entry
ICDCCJ_1390       CDS       T01372                                 

Definition
tRNA pseudouridine synthase D
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Brite
Enzymes [BR:cjn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.27  tRNA pseudouridine13 synthase
     ICDCCJ_1390
Transfer RNA biogenesis [BR:cjn03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ICDCCJ_1390
 Prokaryotic Type
    ICDCCJ_1390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1424497..1425615)
Genome map
AA seq 372 aa AA seqDB search
MNLEEENTIFKPLYSLKHSPINAYFSKNSDDFVVRERPLYEFSGKGEHLILHINKKDLTT
NEALKILSETSGVKIRDFGYAGLKDKQGSTFQYLSMPKKFESFLSNFSHPKLKILEIFTH
ENKLRIGHLKGNTFFIRLKKVLPSDALKLEQALMNLDKQGFTNYFGYQRFGKFGDNYKEG
LEILRGKKMKNVKMKEFLISAFQSELFNRYLSKRVELSHFANDFSEKELIQIYKISKEEA
KELKKQEQFFKLLKGEVLGHYPFGKCFLCEDLSVELGRFKARDISAMGLLIGAKACETGE
GLALNLENEIFKDTLEFKAKMQGSRRFMWGYLEELKWRYDEEKAHFCIEFFLQKGSYATV
VLEEILHKNLFE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaggaagagaacaccatttttaagcctttgtatagtttaaaacacagtcct
attaatgcgtattttagtaaaaatagcgatgattttgtagtgcgtgaaaggcctttgtat
gaatttagcggtaagggtgaacatcttattttgcatatcaataaaaaagatttaaccaca
aatgaagctttaaaaattttaagcgaaacaagcggggttaaaataagagattttggttat
gcagggcttaaagataagcaaggatcaacctttcaatacctttctatgcctaaaaaattt
gagagttttttgtcaaatttttctcatcctaaacttaaaattttagaaatttttacccat
gaaaacaagctaagaatagggcatttaaaaggaaatacttttttcatacgcttaaaaaaa
gttttaccaagcgatgctttaaaactagaacaagctttgatgaatttggataagcaaggt
tttacgaattattttggttatcagcgttttggaaaatttggggataattataaagaaggg
cttgaaattttgcgtggcaaaaaaatgaaaaatgtaaaaatgaaagagtttttaatttca
gcttttcaaagtgagctttttaatcgctatttgagcaaaagagtggagttatcacatttt
gcaaatgattttagcgaaaaagaattgatccaaatttataaaatttctaaagaagaagct
aaggaacttaaaaaacaagaacaattttttaagcttttaaaaggtgaggttttagggcat
tatccttttggaaagtgttttttatgcgaggatttaagtgttgagcttgggcgttttaag
gcaagagatataagcgccatggggcttttaatcggtgctaaggcttgtgaaacaggagaa
ggtttggccttaaatttagaaaatgaaatttttaaagatactttggagtttaaggctaaa
atgcaaggttcaagacgctttatgtggggatatttagaagagttaaaatggcgttatgat
gaagaaaaagctcatttttgtatagagtttttcttgcaaaaaggctcttatgctactgtg
gttttagaagaaattttgcataaaaatttgtttgaatga

DBGET integrated database retrieval system