KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_1455Help
Entry
ICDCCJ_1455       CDS       T01372                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ICDCCJ_1455
   00052 Galactose metabolism
    ICDCCJ_1455
   00500 Starch and sucrose metabolism
    ICDCCJ_1455
   00520 Amino sugar and nucleotide sugar metabolism
    ICDCCJ_1455
Enzymes [BR:cjn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     ICDCCJ_1455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1497788..1498612)
Genome map
AA seq 274 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGIENMGFVTGRGKR
ALEDYFDISYELEHQISGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGRPLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVISGNFIED
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTKAGKNGEIQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFYEKSKC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtattttccctgcggcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaaccaaacctttgatccattatggtgtt
gatgaagctttggaagcaggaattgaaaatatgggctttgtcacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgagcatcaaatttcaggtacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgcacctttacttttaca
agacaaaatcaaatgaaaggtttaggtgatgcggttttaaaaggtagacctttggttggc
gatgaagcttttggcgtaattttagctgatgatttgtgtgtcaatgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagaacaagtttcaaactatggagtaatttctggaaattttatagaagat
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
aaagcaggaaaaaatggtgaaattcaacttaccgacgcgcttttaactcaagcaaccaat
ggtatggttttagcttataaatttcaagggaaacgctttgattgtggaagtgtagaaggc
tttgtagaggcgacaaattatttttacgagaaaagtaaatgttaa

DBGET integrated database retrieval system