KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_16Help
Entry
ICDCCJ_16         CDS       T01372                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Brite
Enzymes [BR:cjn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ICDCCJ_16
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23561..24475)
Genome map
AA seq 304 aa AA seqDB search
MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMDKSLSKDGKVSCNTCH
RLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRAKDLTEQAMGPFFNPKE
MGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAVAEFEKTLITPNSPFDRYLSGDQ
NAISTQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEYPNQEDLGRYEITKREADK
MVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKFLDQETVDNIVAFLESLTGE
YHDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatgattttatgtttatcttatgcaaatatagtctttgcagtagat
atgataacccctattccaaattccatctcttatgataaagaaaaagctaaacttggaaaa
agtctttatatggataaaagtttatccaaagatggaaaagtttcgtgcaatacttgccat
aggcttgatcaacacggtgttgatgggcttgaattttcaataggagttgataatcaactc
gataaaccctttaacactcctacaacctttaattctgtgtttaattttgtgcaattttgg
aatggcagagctaaagatttaacagaacaagctatgggaccttttttcaatccaaaagaa
atggggctaagtcctgaacttcttttacaaaaagttaattcaaatgaaaattatgtaaaa
acttttaaaaaactttatggagaagttacggtagaaaacatagcccttgcagttgctgaa
tttgaaaaaaccttaatcaccccaaattctccttttgatcgctatcttagcggggatcaa
aatgctatttcaactcaagctaaaaaaggttacgaagattttaaagctaatggctgcatc
tcttgtcatcaaggtcaaaatataggcgggaatatgtttcaaaaaatcggtatttttgaa
gaatacccaaaccaagaagatttagggcgttatgaaatcacaaaaagagaagctgataaa
atggtatttaaggttcctagtcttagaaatatagccaaaaccgcgccttattttcatgat
ggttctatacctactttagatgcttgtgttcagtttatggcttactatcaactaggaaaa
tttttagatcaagaaacagttgacaatatagttgcattcttagaaagcttaacaggagaa
tatcatgacaaataa

DBGET integrated database retrieval system