KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_211Help
Entry
ICDCCJ_211        CDS       T01372                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Brite
Enzymes [BR:cjn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     ICDCCJ_211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(218020..218649)
Genome map
AA seq 209 aa AA seqDB search
MNAFEQKRCQNMAEEIAQKVFINEELFNAFCQIPREIFSPLKAHAYRLDALPLANSQWIS
SPLTVAKMTMALDFKNADSILEIGCGSGYQAAILSKVIRRVFTIERIENLAKKAAQTFRE
LELFNINVKFDDGQNGWKNYAPYDRILFSAYATQIPEILLDQLSDDGILVAPILHNGKQF
ITRLRKNGTNLQKEILEECLFVPIADGKE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcatttgaacaaaaaagatgtcaaaatatggctgaagaaattgcacaaaaagtt
tttatcaatgaagaactttttaatgctttttgtcaaattccgcgtgaaattttttctcct
ttaaaagcccatgcttatcgccttgatgctttgcctttagcaaattctcaatggattagt
tcacctttaactgtagctaaaatgactatggccttagattttaaaaatgctgatagtatt
ttagagataggttgtggaagtggctatcaagctgcgattttaagcaaagtcataaggcgt
gtttttaccatagaacgcatagaaaatttagccaaaaaagccgctcaaactttcagagaa
ttagaactttttaatatcaatgtaaaatttgatgatgggcaaaatggctggaaaaattat
gctccttatgataggattttattttctgcttatgcgacacaaattcctgaaattttactc
gatcaattaagtgatgacgggattttagtcgctcctattttacacaatggcaaacaattc
atcacacgccttagaaaaaatggcacaaatttacaaaaagaaattttagaagaatgttta
tttgtgcctatagcagatgggaaagaataa

DBGET integrated database retrieval system