KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_319Help
Entry
ICDCCJ_319        CDS       T01372                                 

Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ICDCCJ_319
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ICDCCJ_319
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ICDCCJ_319
Enzymes [BR:cjn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ICDCCJ_319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323805..324365
Genome map
AA seq 186 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
KAILSR
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattggatcaaagccctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggcgtggatattcatagtgtttttgagcttttagct
aggataaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttaattaaagagtgtgaaagatataatatagct
ttaattacacttgtaagtgttacaacccctaaagaaagggttaaaaagttagtaaaacat
gctaaaggttttatttatttattagcaagcataggtattacaggtacgaaaagtgtcgaa
aaagcaatcttgtcaagataa

DBGET integrated database retrieval system