KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_327Help
Entry
ICDCCJ_327        CDS       T01372                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Brite
Enzymes [BR:cjn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ICDCCJ_327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
329835..330860
Genome map
AA seq 341 aa AA seqDB search
MKVKALLIASLVAFSSLNAASLIDEAKNSGLVALPKDQKGVDEILKQNGVKASEFTLEKA
ELGKKLYFEPRLSKSGIISCNTCHNVGLGGTDGVSTAIGHKWTANPHHLNSPTVYNAVLN
NTQFWDGRAGTLADQAKGPIQADPEMATPAKLAVEKISSLPEYVSEFKKIYGKSGVNFDN
IADAIANFERTLITPSRFDKFLEGDEKALTKEEQKGLKLFIDKGCVACHNGVNLGGNMQA
FEVAGKYKFANLGDFKGDANGMVKTPTLRNVAETAPYFHNGAIWNLKDAIKEMGSVQLGI
KISDKEAKSIETFLKSLTGTKPAIVYPQLPISTEKTPKPEL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaaaagcattgctaatcgcatccttagttgctttttcaagcttaaatgctgca
agtcttatagatgaagctaaaaattcaggtcttgttgccttgccaaaagatcaaaaaggt
gttgatgaaattttaaaacaaaatggagtaaaggctagtgaatttactcttgaaaaagca
gagcttggcaaaaagctttattttgaaccacgcctttcaaaaagtggtatcatttcttgt
aatacctgtcacaatgtaggacttggtggaacagatggggttagtactgcaataggtcat
aaatggacagcaaatccccatcatttaaattcaccaacagtttataatgcggttttaaat
aatactcaattttgggatggtcgtgcaggaacattagccgatcaagctaaaggtccaatc
caagctgatcctgaaatggcaactcctgctaaactcgcagtagaaaaaatttcatcattg
cctgaatatgtgagtgagtttaaaaaaatctatggtaaaagtggtgtaaattttgacaat
attgctgatgcaattgcaaattttgaaagaaccttgatcactccatctcgttttgataaa
tttttagaaggcgatgaaaaagctttaacaaaagaagagcaaaaaggcttaaagcttttt
atagacaagggttgtgtagcttgtcataatggtgtgaatttaggtggcaatatgcaagcg
tttgaagttgctggtaaatataaatttgcaaatttaggtgattttaaaggtgatgcaaat
ggcatggtaaaaactccaactttaagaaatgttgctgaaactgctccatattttcataat
ggcgctatttggaatctaaaagatgctattaaggaaatgggtagtgtgcaacttggcatt
aaaatttctgataaagaagcaaaaagtattgaaactttcttaaaatccttaacaggaaca
aaaccagcaattgtttatccacaacttcctatttctactgaaaaaactcctaaacctgaa
ctataa

DBGET integrated database retrieval system