KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_450Help
Entry
ICDCCJ_450        CDS       T01372                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ICDCCJ_450
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ICDCCJ_450
Enzymes [BR:cjn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     ICDCCJ_450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
457734..458510
Genome map
AA seq 258 aa AA seqDB search
MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALKRVEKEVKIIAEVKKA
SPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYLSLIRRYTQIPLLRKDF
IFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLEALVEIHDKEDLSKAIFA
GADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLENKEFLEHLQNLGVDAFLI
GEYFMREKDEGKALKALL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaatttttgaaaaaacaaaagaagatttaaaagaacgcaaactaaaa
cttccttatgatatgttagggcgttctttagcttcaaatcctttctttccaaaagatgtg
attaaggctttaaaaagagtagaaaaagaagttaaaatcatagcagaagtaaaaaaagca
agccctagcaagggagtcattagagaagactttgatcctttgagtatcgctttaaattat
gagaagaacaaagctgcggcgatttctgttttaactgagccgcatttttttaaaggttct
ttagaatacttaagtcttatacgccgttatacgcaaattcctttacttagaaaagatttt
atctttgatgagtatcaaattttagaagctttggtttatggggcggattttgtattatta
atcgctaaaatgctaagcatgaaagagcttaaaaaactgcttgagtttgcaagacattta
ggtcttgaggctttggttgaaattcatgataaagaggatttgagtaaggctatttttgct
ggagcggatatcattggtatcaatcatcgtaatttagaggattttactatggatatgagt
ttgtgcgaaaaacttatcccacaaatcccaaattcaaaaatcatcatcgcagaaagtggt
ttagaaaataaagaatttttagagcatttgcaaaatttaggcgttgatgcttttttaatc
ggcgaatattttatgcgcgaaaaagatgaaggaaaggctttaaaagctttgctttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system