KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_480Help
Entry
ICDCCJ_480        CDS       T01372                                 

Definition
succinyl-CoA synthase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ICDCCJ_480
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ICDCCJ_480
   00640 Propanoate metabolism
    ICDCCJ_480
   00660 C5-Branched dibasic acid metabolism
    ICDCCJ_480
Enzymes [BR:cjn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ICDCCJ_480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
492104..493267
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKAIFADNGIPTLKGKVAFSVDEAVANAKELGGSVWAVKAQIHAGGRGLGGGV
KIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANIVKEYYLAILFNRMAEQ
ITIIASSEGGMDIEKVAKESPEKIAKVSIDPQIGFKMFHGLEVARVLGLDKDEGKKLISM
IAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSALYRHPEIAELRDITEENP
AEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGAKPANFLDVGGGASPETVAK
AFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVEVNIPIVVRLDGTNAAEAKTI
LDNSNLKNIKAATNLKNGAELVKSLVG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgagtatcaagcaaaagcaatttttgcagacaatggcatccctacctta
aagggaaaagttgcatttagcgtagatgaagctgtggctaatgctaaagaattaggcggt
agtgtttgggcagttaaagctcaaattcacgcaggaggccgtggtcttggtggtggtgtt
aaaatcgctaagaatttagatgaggtaaaagattacgcaagtaaaattttaggaatgaat
ttagtaactcatcaaacaggacctgaaggtaagctcgtgcaaaaactttatatagaaagt
ggcgctaatatagtaaaagagtattatttggctattttatttaatagaatggcagagcaa
attaccattatcgcttcaagtgaaggagggatggatatagaaaaagtagccaaagaaagt
cctgaaaaaattgcaaaagtaagtattgatccacaaattggatttaaaatgtttcatgga
cttgaagtagcgagagttttaggacttgataaagatgaaggcaaaaaactcatttctatg
atagctaaactttataagctttacatggataaagatatgaatatgcttgaaatcaatcct
ttaattaaaactgcagaaggggatttttatgcccttgatgcaaaatgcagttttgatgat
agtgcgctttatcgtcatcctgaaattgctgaacttagagatattactgaagaaaatcct
gctgaaagagaagcggctgaatttggcttaagctatgtgaaattagatggagatgtagct
tgtatggtaaatggtgcgggtctagcaatggcaactatggatattattaattatagtggt
gcaaaacctgcaaatttcttagatgtaggtgggggggcttctcctgaaactgttgcaaag
gcttttgaaattattttaagagataagaatgtaaaagttatatttatcaatatctttggt
ggtattgttcgttgtgataggatagcaaatggaattttagaagctactaagaatgttgag
gtaaatattccaattgtagtgcgtcttgatggcactaacgcagcagaagcaaagacaatt
ttagataattcaaatcttaaaaatatcaaagcagcaaccaatcttaaaaacggtgcagag
cttgtaaaaagtttagtaggataa

DBGET integrated database retrieval system