KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_771Help
Entry
ICDCCJ_771        CDS       T01372                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    ICDCCJ_771
Enzymes [BR:cjn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     ICDCCJ_771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(785128..785679)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLASAQATSTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttcgcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttattactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcagtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttgggcgatgaaagcgtgcttaaaaaagtacctggcataggtccaaaaagt
gcaaaacgcattatagtagaactttctgacacaaaaaccaaacttgaaaatgtaagcgat
gataaaagcgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagcaagtgctcaagcaacaagcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system