KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_785Help
Entry
ICDCCJ_785        CDS       T01372                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cjn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cjn00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cjn00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
798948..800306
Genome map
AA seq 452 aa AA seqDB search
MINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFGFGEEELFKKALKSYESFD
DKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSEFSKDKNILIICATSGDTG
PATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKVFAIDEDFDAAQRTLKELL
FSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLFNEFLEEVQIIVPSGNFGN
ALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYDLREKSLKKTISPAMDILISSNIE
RLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEADFCTDEECMQFIKQSKILI
DPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSKNEKEDLKFIAKEFNVQVK
DEILALFDLKNSDEKVFEARNIKKEILDWMQK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
ttgattaacccaaacgctccagaaggagggctttactcacctttaaatttgcctattttt
gaaggagaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagt
tttggttttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgat
gataaaaatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctt
tggcatgggcctacaagagcttttaaagatatggctttacagccttttggcgtgctttta
agcgaattttcaaaggataaaaatattttaattatctgtgctacaagcggcgatacaggg
cctgcaaccctaaaaagttttgaaaatgcaaaaaatgttaaagtagcttgtatgtatcca
aaaggtggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataacttg
aaagtttttgccatagatgaggattttgacgcagcgcaacgcactttaaaagaattgctt
ttttcaaaagattttcaaaatgaaattaaagctttaaattatgagctttgcgcagctaat
tctgtaaattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaa
ctttttaatgagtttttagaagaagtacaaatcatcgttccaagtggaaattttggcaat
gctttaggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgct
tcaaacgcaaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaa
aaaagtcttaagaagactatttctccagctatggatatacttatttcatctaatatcgaa
agacttttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttaaaa
aatgaaagatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgag
gcggatttttgcaccgatgaagaatgtatgcaatttatcaaacaaagcaagattttaatc
gatccgcataccgcaacttgttttaaaatgcttgatcctttaaaacctagcattatcact
tctacagcagaatggacaaaatttactccaagtatgataaaagctttatatgatagggat
tctaagaatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaa
gatgaaattttggctttatttgatttgaaaaatagcgatgaaaaggtatttgaagccaga
aatataaaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system