KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ_90Help
Entry
ICDCCJ_90         CDS       T01372                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ICDCCJ_90
  Amino acid metabolism
   00330 Arginine and proline metabolism
    ICDCCJ_90
Enzymes [BR:cjn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     ICDCCJ_90
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
112475..113230
Genome map
AA seq 251 aa AA seqDB search
MKRIVVKVGSHVISEENTLSFERLKNLVTFLAKLMEKYEVILVTSAAISAGHTKLDIDRK
NLINKQVLAAIGQPFLISVYNELLTKFNKLGGQILLTGKDFDSRKATKHAKNAIDMMINL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKR
LEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGFDLSVAKTFLL
EDKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagttgttaaagtgggttctcatgtgattagcgaagaaaacactttaagt
tttgagcgtcttaaaaatttagtcacatttttagctaaactcatggaaaaatatgaagtg
attttagtaacttcagcggctatttcagcaggacacaccaaactagatatcgatagaaaa
aatctcatcaataaacaagttttagccgctattggacaaccttttttaatcagtgtttat
aatgaacttttaaccaaatttaacaaactaggcggacaaattttacttacaggtaaggat
tttgactctagaaaagctactaaacacgcaaaaaatgctatcgatatgatgataaattta
ggaattttgcctattatcaatgaaaatgacgctacagctatagaagaaattgtctttggt
gataatgatagcttaagtgcttatgctacgcatttttttgatgcggatttgcttgtgatt
ttaagcgatattgatggattttatgataaaaatcctagtgaatttagtgatgcaaagcgt
ttagaaaaaatcactcatattaaagaagaatggctacaagcaaccataaaaacaggtagt
gagcacggaacgggtggtatagtaaccaaacttaaggcagctaaatttttacttgaacac
aataaaaaaatgtttttagcaagtggctttgatttaagtgtggcaaagacatttttatta
gaagataaacaaataggtggaactttgtttgagtga

DBGET integrated database retrieval system