KEGG   Coturnix japonica (Japanese quail): 107310754Help
Entry
107310754         CDS       T04297                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107310754 (ABHD12)
Peptidases [BR:cjo01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107310754 (ABHD12)
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107310754 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 381 aa AA seqDB search
MRKRNESVTVEHERAAAAPAPLDKGCSLRHSLRLPAADTGMKRPLGRRHGLWFRLRRLII
WLLGVYIAIPFLVKLCPAIQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVT
IGVWHTVPAALWKNARGKDQLWFEDALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLG
YHVVTFDYRGWGDSIGSPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVR
RLCERETPPEALILESPFTNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDEN
VKYISCSLLILHAEDDPVVPFHLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYR
SPELPRILREFLGVPEHEHHH
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcgcaacgagtcggtcacggtggagcatgagcgcgccgccgccgcgcccgcg
cctctcgacaagggctgcagcctgaggcacagcctgcgtctgcccgccgccgacacgggc
atgaagcgaccgctcggcaggcgacatgggttatggttccgattgcggaggctgataatc
tggctgctgggagtgtacatagccattccatttctagtaaaactttgccctgctattcag
gcgaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaaagacca
caagatcagggcttaaaccacacctgtaattattaccttcagccagaggaggatgtaacc
attggagtctggcatactgtccctgcagccttatggaagaatgcccgagggaaggaccag
ctgtggtttgaagatgctttgggttccagccatcctgtgatcctttacttgcacggcaat
gcgggaacaagaggaggggatcaccgtgtggagctttataaggtcctcagctcccttggg
taccacgtggtcacgtttgattatcgaggctggggtgattcaataggcagcccgtcggag
aggggaatgacctacgatgcccttcatgtctttgactggataaaagcaagaagtggagac
aaccctgtctatatatggggacactccttgggcacaggggtcgcaacaaacctagtgagg
cgcctttgtgagagagaaacaccccctgaagcgctgatactggaatctccattcaccaac
atacgggaggaggcgcgaagtcatcccttttctgtgatctacagatatttcccagggttt
gactggttcttccttgaccccatcacgacaagtggaattaaatttgcaaatgatgagaat
gtgaagtacatttcctgctccctgctcatccttcacgctgaggatgacccggtggtaccg
tttcatctgggaaagaagctttacaacatcgctgcgacgtcgcggagtttccgagactac
aaggtgcagtttgtcccattccacacagacctcggctatcggcacaagtacatctacagg
agtccagagctacctcgaatactgcgggaattcctgggagtacctgaacatgagcatcat
cactga

DBGET integrated database retrieval system