KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_00095Help
Entry
A911_00095        CDS       T02264                                 

Definition
cytochrome C551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(23688..24587)
Genome map
AA seq 299 aa AA seqDB search
MILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMDKSLSKDGKVSCNTCHRLDQH
GVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRAKDLTEQAMGPFFNPKEMGLSP
ELLLQKVNSNENYVKTFKKLYGEVTVENIALAVAEFEKTLITPNSPFDRYLSGDQNAIST
QAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEYPNQEDLGRYEITKREADKMVFKV
PSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKFLDQETVDNIVAFLESLTGEYHDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgattttatgtttatcttatgcaaatatagtctttgcagtagatatgataacccctatt
ccaaattccatctcttatgataaagaaaaagctaaacttggaaaaagtctttatatggat
aaaagtttatctaaagatggaaaagtttcatgcaatacttgccataggcttgatcaacac
ggtgttgatgggcttgaattttcaataggagttgataatcaactcgataaaccctttaac
actcctacaacctttaattctgtgtttaattttgtgcaattttggaatggcagagctaaa
gatttaacagaacaagctatgggaccttttttcaatccaaaagaaatggggctaagtcct
gaacttcttttacaaaaagttaattcaaatgaaaattatgtaaaaacttttaaaaaactt
tatggagaagttacggtagaaaacatagcccttgcagttgctgaatttgaaaaaacctta
atcaccccaaattctccttttgatcgctatcttagcggggatcaaaatgctatttcaact
caagctaaaaaaggttacgaagattttaaagctaatggctgcatctcttgtcatcaaggt
caaaatataggtgggaatatgtttcaaaaaatcggtatttttgaagaatacccaaaccaa
gaagatttagggcgttatgaaatcacaaaaagagaagctgataaaatggtatttaaagtt
cctagtcttagaaatatagccaaaaccgcgccttattttcatgatggttctatacctact
ttagatgcttgtgttcagtttatggcctactatcaactaggaaaatttttagatcaagaa
acagttgacaatatagttgcattcttagaaagcttaacaggagaatatcatgacaaataa

DBGET integrated database retrieval system