KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_00310Help
Entry
A911_00310        CDS       T02264                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A911_00310
Enzymes [BR:cjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     A911_00310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(79247..79582)
Genome map
AA seq 111 aa AA seqDB search
MLFRVMMDDKRFKILSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVK
FKRKRTFKNAPRTLDLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgctttttcgagtaatgatggatgataaaagatttaaaattttatccacatctcctatg
ttgataaatgaagcctttggttttaaagagcaaaaagattttaccaatgctgttatgttg
atacaaactaatttgcatgcacgagcacttttgaaagttttactttactatgaagtaaaa
tttaaacgcaagagaactttcaaaaacgctcctagaacgcttgatttagatcttttatac
ttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcctcataaaggggctaaagaa
agagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system