KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_00460Help
Entry
A911_00460        CDS       T02264                                 

Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00330  Arginine and proline metabolism
cjp00332  Carbapenem biosynthesis
cjp01100  Metabolic pathways
cjp01130  Biosynthesis of antibiotics
cjp01230  Biosynthesis of amino acids
Module
cjp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    A911_00460
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    A911_00460
Enzymes [BR:cjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     A911_00460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: AFU42231
Structure
PDB: 

Jmol
Position
106421..107176
Genome map
AA seq 251 aa AA seqDB search
MKRIVVKVGSHVISEENTLSFERLKNLVAFLAKLMEKYEVILVTSAAISAGHTKLDIDRK
NLINKQVLAAIGQPFLISVYNELLAKFNKLGGQILLTGKDFDSRKATKHAKNAIDMMINL
GILPIINENDATAIEEIVFGDNDSLSAYATHFFDADLLVILSDIDGFYDKNPSEFSDAKR
LEKITHIKEEWLQATIKTGSEHGTGGIVTKLKAAKFLLEHNKKMFLASGFDLSVAKTFLL
EDKQIGGTLFE
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatagttgttaaagtgggttctcatgtgattagcgaagaaaacactttaagt
tttgagcgtcttaaaaatttagtcgcatttttagctaaactcatggaaaaatatgaagta
attttagtaacctcggcggctatttcggcaggacacaccaaactagatatcgatagaaaa
aaccttattaataaacaagttttagctgctattggacaaccttttttaatcagtgtttat
aacgagcttttagccaaatttaacaaactaggcggacaaattttacttacaggcaaggat
tttgactctagaaaagctactaaacacgcaaaaaatgctatcgatatgatgataaattta
ggaattttgcctattatcaatgaaaatgacgctacagctatagaagaaattgtctttggt
gataatgatagtttaagtgcttatgctacgcatttttttgatgcggatttgcttgtgatt
ttaagcgatattgatggattttacgataaaaatcctagtgaatttagtgatgcaaagcgt
ttagaaaaaatcactcatattaaagaagaatggctacaagcaaccataaaaacaggtagt
gagcacggaacaggtggtatagtaaccaaacttaaggcagctaaatttttacttgaacac
aataaaaaaatgtttttagcaagtggctttgatttaagtgtggcaaagacatttttatta
gaagataaacaaataggtggaactttgtttgagtga

DBGET integrated database retrieval system