KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_01685Help
Entry
A911_01685        CDS       T02264                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    A911_01685
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A911_01685
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    A911_01685
Enzymes [BR:cjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     A911_01685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
318616..319794
Genome map
AA seq 392 aa AA seqDB search
MKKAYYGDFGGQFLPESAMFALNELEGAFLKFSKDKLFKKELNELLKTYVGRPTPLYFAR
NLSKKYQHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAA
ALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKN
IFYVVGSAVGPYPYPKMVTHFQSIIGKECKMQLQKLNKKVDYIIAAVGGGSNAAGIFYDF
IKDENVKLIGIEAGGLGIDTPYHAATLNKGKTGIIHGMKTKVLQDDLGNILPVHSVSAGL
DYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPT
LKKKSVIVVNLSGRGDKDMQMIRDYKKGVIYG
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgtattatggggattttggtgggcagtttttgcctgaaagtgcaatgttt
gctttaaatgagctagaaggtgcttttttgaaattttctaaagataaactctttaaaaaa
gaattaaacgagcttttaaaaacttatgtagggcgtcctactccactttattttgctaga
aatttaagcaaaaaatatcagcatgaaatttatttaaaacgcgaggatttaaatcatacc
ggagcacataaaatcaataatgccatcgctcaagcccttttagcaaaaaaaatgggaaag
aaaaaaatcatagcagaaacaggagcaggtcaacacgggcttgcaacagccactgcagca
gcacttttaggacttgaatgtgaaatttatatgggggcaactgatgtacaaagacaggct
ttaaatgtttataaaatggagcttttgggtgctaaaattcatgcagtacaaagtgggctt
aaaactctaaaagaagctactactgcggctattcaagcttgggttggagatattaaaaat
attttttatgtggttggaagtgcggtaggtccttatccttatcctaaaatggtaacgcat
tttcaaagcattataggaaaagaatgcaaaatgcaacttcaaaaactcaataaaaaagta
gattatattatcgcagctgttgggggtggaagcaatgcagctgggattttttatgatttt
atcaaagatgaaaatgttaaacttataggtattgaagcaggggggcttggcatcgataca
ccttatcatgcagcgactttaaataagggaaaaacaggcattattcacggtatgaaaacc
aaggttttacaagatgatttaggcaatatcttgcctgtgcatagtgtttctgcagggctt
gattatccaggaattggccctttgcatgcttttttatttgaaagtaaaagagcgcaatat
catgctataagtgatgaagaatgtatgcaagctttaaaattactttgcaaagaggaaggt
attattgcagcgattgaaagttcgcatgctttagcgtttttagaaaaactttgtccaact
ttaaaaaagaaaagcgtgatagtagtaaatctttcaggtaggggagataaggatatgcaa
atgattagagattataaaaaaggggtgatttatggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system