KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_02855Help
Entry
A911_02855        CDS       T02264                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cjp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
543955..545097
Genome map
AA seq 380 aa AA seqDB search
MKFFKINPNTDFNLLCSFINPHKMGQKIMSEKTKIHFIFIKDISTPAANILKQDALRVGA
ELITHKEVITAKITHSNALLMASKEQIQKLVVKEKLQDFGLKNLALFLQKDFLKPKKAEL
MAVINVNEDSFNAKSRVSEEDFEKRLNDFLALKPEYIDIGAVSSRPGSEYCGKEEEFKRL
KKVLDLIYEKNYYEQAIFSLDSFDEYCLEYALNKGFKLINDITSLRNLNLAKLASKYGAK
YCLMHMQNNPNNMQDNPFYEDLLDEMTLFFKEKLELLESFGVKESILDVGIGFGKSAGHN
MILIKHLEHFLQFNKPLLIGASRKSVINAYFQSEIKDRLAGTLYLHLKAFENGASIIRVH
DLYEHKQLFALAQAMDNIGV
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttttaaaatcaatccaaacaccgattttaatttgctttgttctttcataaac
cctcataaaatgggacaaaagatcatgagtgaaaaaacaaaaattcattttatttttatc
aaagatatttctactcctgcggcaaatattttaaaacaagatgctttaagagtaggagct
gaacttattactcataaagaagtaattactgcaaaaatcactcattcaaatgcgctttta
atggcaagtaaagagcaaattcaaaagcttgttgtcaaagaaaaacttcaagattttgga
cttaaaaatttggctctttttttgcaaaaagattttttaaaaccgaaaaaagccgagctt
atggcagtgattaatgtcaatgaagacagttttaatgcaaaaagtcgtgtgagtgaagaa
gactttgaaaaaaggcttaatgactttcttgctttaaagcctgaatatatcgatataggt
gcggtaagctcaagacctgggagtgagtattgtggcaaggaagaggaatttaaaagactg
aaaaaagtacttgacttaatttatgagaaaaattattacgaacaagcaatttttagttta
gatagttttgatgaatattgtctagaatatgctttaaataagggttttaaactcattaat
gatattacaagtttaagaaatcttaatctagccaaacttgcaagtaaatatggggcaaaa
tattgcttaatgcacatgcaaaacaatccaaataacatgcaagataatcctttttatgaa
gatttgcttgatgagatgactttgttttttaaagaaaaacttgagcttttagaaagtttt
ggagtaaaagaaagtattttagatgtaggtattggttttggaaagagtgcggggcataat
atgattttaatcaaacacttagaacattttttgcaatttaataaacctttacttataggt
gcgagtcgtaaaagtgtgattaatgcgtattttcaaagcgagattaaagatcgtttagcg
ggaactttatatttgcatttaaaggcttttgaaaatggtgctagtattataagagtgcat
gatttatatgagcataaacaactttttgctttagcgcaggcaatggataatataggagtt
tag

DBGET integrated database retrieval system