KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_03875Help
Entry
A911_03875        CDS       T02264                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cjp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(750915..751466)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLVSAQATGTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttctcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttatcactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcggtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttgggcgatgaaagcgtgcttaaaaaagtacctggcataggtccaaaaagt
gcaaaacgcattatagtagaactttctgacacaaaaaccaaacttgaaaatgtaagcgat
gataaaagcgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagtaagtgctcaagcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system