KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_03940Help
Entry
A911_03940        CDS       T02264                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00260  Glycine, serine and threonine metabolism
cjp00750  Vitamin B6 metabolism
cjp01100  Metabolic pathways
cjp01110  Biosynthesis of secondary metabolites
cjp01120  Microbial metabolism in diverse environments
cjp01230  Biosynthesis of amino acids
Module
cjp_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A911_03940
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A911_03940
Enzymes [BR:cjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     A911_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N CbiA
Motif
Other DBs
NCBI-ProteinID: AFU42888
Position
764711..766123
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILALFDLKNSDEKVFEARNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggtcgagagtagaaatgtaaataatgtatcaagttttaaggaagctttgatt
aacccaaacgctccagaaggagggctttactcacctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
gggcctacaagagcttttaaagatatggctttacagccttttggcgtgcttttaagcgaa
ttttcaaaggataaaaatattttaattatctgtgctacaagcggcgatacagggcctgca
accctaaaaagttttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataacttgaaagtt
tttgccatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaatgaaattaaagctttaaattatgagctttgcgcagctaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcatcgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaac
gcaaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttaaaaaatgaa
agatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagcaagattttaatcgatccg
cataccgcaacttgttttaaaatgcttgatcctttaaaacctagcattatcacttctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatatgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttggctttatttgatttgaaaaatagcgatgaaaaggtatttgaagccaggaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system