KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_04800Help
Entry
A911_04800        CDS       T02264                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00860  Porphyrin and chlorophyll metabolism
cjp01100  Metabolic pathways
cjp01110  Biosynthesis of secondary metabolites
cjp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A911_04800
Enzymes [BR:cjp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     A911_04800
Exosome [BR:cjp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A911_04800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AFU43049
Position
complement(926726..927709)
Genome map
AA seq 327 aa AA seqDB search
MFKRFRRLRLNENLRSMVRENSLSVNDLIYPLFVVNGTGIKKEISSMPDVFQMSLDEILK
ECQNVVNLGIKAIILFGVLENEKKDSCGSDALDDEGLVARSIREIKKNFPDLFIISDLCF
CEYTDHGHCGIIDPKTKSVDNDATLEISAKQALVHARAGVDMVAPSGMMDGVITTLRKAL
DKEGFENLPIMAYSTKFASSYYGPFRDVAESAPSYGDRKSYQMDFANGKEALEESLEDEA
QGADILMVKPALAYLDVVKEISLHSNLPLCVYNVSGEYAMLKAAKNAGVIDYEKVLYETI
IAFKRAGAKLIITYHAKELAKTLKGEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagattaaggcttaatgaaaacttaagatctatggtaagggaa
aattctttaagtgtaaatgatttgatttatccgctttttgtggttaatggaacggggata
aaaaaagaaatttcttctatgcctgatgtgtttcaaatgagtttagatgaaattttaaaa
gagtgtcaaaatgtagttaatttaggcattaaagccattatactttttggtgttttagaa
aatgagaaaaaagacagttgtggaagcgatgctttagatgatgaagggcttgttgcaaga
agtataagagagattaagaaaaattttccagatctttttataatcagtgatctttgtttt
tgtgaatacacagatcacgggcattgtgggattatcgatccaaaaacaaaaagcgtagat
aatgatgcaactttagaaatttcagccaagcaagccttagttcatgcaagagcaggggta
gatatggtagcacctagtggaatgatggatggtgttatcactactttgcgcaaagcttta
gataaggaaggttttgaaaatttgcctataatggcgtattctactaaatttgcatcaagt
tattatgggccatttcgagatgtagcagagtcagctccaagttatggagatagaaaaagc
tatcaaatggattttgctaatggtaaagaagctttagaagaaagcttggaggatgaagca
caaggagctgatattttaatggtaaaacctgcccttgcttatcttgatgtggttaaagaa
atatcccttcattctaacttgcctttgtgtgtttataatgtaagcggagagtatgctatg
ttaaaggcagctaaaaatgcaggagtgattgattatgaaaaagttttgtatgaaactata
atagcttttaaaagagcaggggcaaagcttatcatcacttatcatgctaaagaattagct
aaaacgttaaaaggagaaaaatga

DBGET integrated database retrieval system