KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_05070Help
Entry
A911_05070        CDS       T02264                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00300  Lysine biosynthesis
cjp01100  Metabolic pathways
cjp01120  Microbial metabolism in diverse environments
cjp01230  Biosynthesis of amino acids
Module
cjp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    A911_05070
Enzymes [BR:cjp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     A911_05070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42 Peptidase_M18 KNTase_C
Motif
Other DBs
NCBI-ProteinID: AFU43101
Position
complement(981113..982210)
Genome map
AA seq 365 aa AA seqDB search
MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIKNLLLTKKFKDEGEHL
AFGGHVDVVPAGEGWSNNAFAPVEKEGFIYARGAQDMKSGVAAFVDAVKNADFKGARLSL
ILTSDEEGEAIYGTKAVLEWMQERDMLPDYAVVAEPTCVKKIGDSIKIGRRGSINGKLLI
RGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVITDIRGGMGVCNVTP
NDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSSEAFLTNIDNKIVQKMNESV
QKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKD
LIENF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaagaatttttaatcgaacttttaaaatttaaatctgttacgccaaatgat
gatggagctttaaatttcatcgctatggaactgagtgattttgaagctttttttatagaa
aaagaaggcattaaaaaccttttactcactaaaaaatttaaagatgaaggcgagcattta
gcttttggtgggcatgtagatgtggtgcctgcaggcgagggttggagtaataatgctttt
gcgcctgtggaaaaagaaggctttatctatgcaaggggtgctcaagatatgaaaagcgga
gtagcagcctttgtagatgcggtaaagaatgcggattttaaaggagctaggctgagtctt
attttaacaagtgatgaagaaggcgaagctatatatggaactaaggctgttttagaatgg
atgcaagaaagagatatgctacctgattatgctgtggttgctgagccaacctgtgttaaa
aaaatcggcgatagtattaaaatagggcgtcgtggttctattaatggaaagcttttaatc
cgcggaaaacaagggcatgttgcttatcctgaaaaatgtatcaatcctgtgcatgatttt
gcaccggttttaaagcttttagcgggttttgatcttgatcctggaagtgctgaatttagt
ccttcaaaaatcgttataactgatattcgtggaggtatgggggtatgtaatgtaacgcca
aatgatttaaaacttatgtttaatgtacgcaattcccctgatacaagcttagaagatgta
aaaagttatgtagaaaaaatttgtcatggtttaaactatgagttagagctaaaacaatca
agcgaagcttttttgacaaatatcgacaataaaatcgttcaaaaaatgaatgaaagcgtt
caaaaaatcacccatgaagtgccagagcttaatactaaaggcggcacaagtgatgcaagg
tattttgcaaaatacggtgtaaaggtagtggaatttggggtttgtaatgatagaattcac
gctattgatgaaagagtaagtatagaagaatttgaaaaactttgccttgtttttaaagac
ttgatagaaaatttttaa

DBGET integrated database retrieval system