KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_05070Help
Entry
A911_05070        CDS       T02264                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cjp01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cjp00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(981076..982173)
Genome map
AA seq 365 aa AA seqDB search
MNAKEFLIELLKFKSVTPNDDGALNFIAMELSDFEAFFIEKEGIKNLLLTKKFKDEGEHL
AFGGHVDVVPAGEGWSNNAFAPVEKEGFIYARGAQDMKSGVAAFVDAVKNADFKGARLSL
ILTSDEEGEAIYGTKAVLEWMQERDMLPDYAVVAEPTCVKKIGDSIKIGRRGSINGKLLI
RGKQGHVAYPEKCINPVHDFAPVLKLLAGFDLDPGSAEFSPSKIVITDIRGGMGVCNVTP
NDLKLMFNVRNSPDTSLEDVKSYVEKICHGLNYELELKQSSEAFLTNIDNKIVQKMNESV
QKITHEVPELNTKGGTSDARYFAKYGVKVVEFGVCNDRIHAIDERVSIEEFEKLCLVFKD
LIENF
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaaagaatttttaatcgaacttttaaaatttaaatctgttacgccaaatgat
gatggagctttaaatttcatcgctatggaactgagtgattttgaagctttttttatagaa
aaagaaggcattaaaaaccttttactcactaaaaaatttaaagatgaaggcgagcattta
gcttttggtgggcatgtagatgtggtgcctgcaggcgagggttggagtaataatgctttt
gcgcctgtggaaaaagaaggctttatctatgcaaggggtgctcaagatatgaaaagcgga
gtagcagcctttgtagatgcggtaaagaatgcggattttaaaggagctaggctgagtctt
attttaacaagtgatgaagaaggcgaagctatatatggaactaaggctgttttagaatgg
atgcaagaaagagatatgctacctgattatgctgtggttgctgagccaacctgtgttaaa
aaaatcggcgatagtattaaaatagggcgtcgtggttctattaatggaaagcttttaatc
cgcggaaaacaagggcatgttgcttatcctgaaaaatgtatcaatcctgtgcatgatttt
gcaccggttttaaagcttttagcgggttttgatcttgatcctggaagtgctgaatttagt
ccttcaaaaatcgttataactgatattcgtggaggtatgggggtatgtaatgtaacgcca
aatgatttaaaacttatgtttaatgtacgcaattcccctgatacaagcttagaagatgta
aaaagttatgtagaaaaaatttgtcatggtttaaactatgagttagagctaaaacaatca
agcgaagcttttttgacaaatatcgacaataaaatcgttcaaaaaatgaatgaaagcgtt
caaaaaatcacccatgaagtgccagagcttaatactaaaggcggcacaagtgatgcaagg
tattttgcaaaatacggtgtaaaggtagtggaatttggggtttgtaatgatagaattcac
gctattgatgaaagagtaagtatagaagaatttgaaaaactttgccttgtttttaaagac
ttgatagaaaatttttaa

DBGET integrated database retrieval system