KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_05315Help
Entry
A911_05315        CDS       T02264                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A911_05315 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A911_05315 (pyrB)
Enzymes [BR:cjp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     A911_05315 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1032508..1033395
Genome map
AA seq 295 aa AA seqDB search
MRHLITTKDFSKSEIMELFKEASDFLDEKPRTFLEGKSITTIFFENSTRTLSSFESAARR
LGARVLRLDVSRSSSSKGEALYDTAANLDAMSPNAIVVRHANSGVPLILAKHIHCPVVNG
GDGKHAHPTQALLDLFTIYNHFQGDVEGKKICIVGDIKNSRVAASNIELLSRFNLDITLV
APPHFMPNTHLKKHYKLDENIIANSDIIMSLRTQTERHNKTVYASLKDYANDFCIQKSLV
KDKKLILLHPGPVNRNIDISDEMMSDERTLVLKQVKNGVAIRMAVLKKLILENEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcactacaaaggattttagcaaaagtgaaattatggagctttttaaa
gaagcaagtgatttcttagatgaaaagcctagaacttttcttgaaggaaaaagtatcacg
acaattttttttgaaaattctacacgcaccctttcatcttttgaaagtgctgcaagaaga
ttaggcgctagggttttacgccttgatgtttcaagatcaagctctagcaaaggagaagct
ctttatgatactgctgctaatttagatgccatgagtcctaatgctattgttgtaagacac
gcaaactcaggagttcccttgatattagcaaagcatatacattgtccagttgttaatgga
ggagatggaaaacacgcccatcctactcaagctttgctagatttatttactatttataat
cattttcaaggtgatgtcgaaggtaaaaaaatttgcatcgtaggtgatattaaaaactct
cgtgtagcagcgtctaatatagaacttttaagcagatttaatcttgatattaccctagta
gctccaccgcattttatgcctaatacccatcttaaaaaacattataagcttgatgagaat
atcatagcaaattcagatattatcatgagtcttagaacacaaacagaaagacataataaa
accgtttacgcttcacttaaagactatgcaaatgatttttgtattcaaaaaagcttagta
aaagataaaaagcttattttactacatccaggccctgtaaatcgcaatattgacataagc
gatgaaatgatgagcgatgaaagaactttagttttaaaacaagttaaaaatggagtggcc
attagaatggctgttcttaaaaaactcatattagaaaatgaaggataa

DBGET integrated database retrieval system