KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_05705Help
Entry
A911_05705        CDS       T02264                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp00230  Purine metabolism
cjp01100  Metabolic pathways
Module
cjp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    A911_05705 (gmk)
Enzymes [BR:cjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     A911_05705 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 ABC_tran RsgA_GTPase MMR_HSR1 AAA_22 Rad17 AAA_29 AAA_14 AAA_19 NTPase_1 KAP_NTPase RNA_helicase ATPase_2 Thymidylate_kin RepB-RCR_reg AAA AAA_17 NACHT NB-ARC DUF2075 cobW AAA_30 T2SSE CSF-1 Cytidylate_kin dNK Methyltransf_12 Zeta_toxin AAA_24 Viral_helicase1 APS_kinase TsaE AAA_28
Motif
Other DBs
NCBI-ProteinID: AFU43226
Position
complement(1104399..1105016)
Genome map
AA seq 205 aa AA seqDB search
MQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEF
QKGIDSDHFLEWARVHENFYGTSLKHTQNALDNGKIVVFDIDVQGFKIARKKMADKIVSV
FITTKNKDELKKRLIKRNTDTIIQLEKRLQNASDEMKELSEYDYLIINDELKQSYEALRA
ILIAHKFRTKGQNLGQIQNIWNEGE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaggttttgttttgttgatttcaggtcctagtggtgctggaaaatcaactctttta
aaaaaactttttgatgaatttgaagatgagctttatttttctatttcttcaacaactcgc
aaaccaagagagggtgaaaaaaatggaatacattatcattttatatcccatgaagaattt
caaaaaggtatagatagtgatcattttttagaatgggctagagtgcatgaaaatttttat
ggtacttctttaaagcacactcaaaatgctttagataatggaaaaatagttgtttttgat
attgatgtgcaaggatttaaaatagccagaaaaaaaatggctgataagattgtttctgtt
tttattactacaaaaaataaagatgagttaaaaaaaagacttattaagcgaaatactgat
acaataatacaactagaaaaaagattacaaaacgctagtgatgaaatgaaagagcttagc
gagtatgattatcttatcattaacgatgagttaaagcaaagttatgaagcattgcgagcg
attttaatcgcccataaatttagaaccaaagggcagaatctagggcaaattcagaatatt
tggaatgaaggagaataa

DBGET integrated database retrieval system