KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_06135Help
Entry
A911_06135        CDS       T02264                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
cjp03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A911_06135 (recR)
DNA repair and recombination proteins [BR:cjp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     A911_06135 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      A911_06135 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 zn-ribbon_14 Ras_bdg_2
Motif
Other DBs
NCBI-ProteinID: AFU43310
Position
1193876..1194448
Genome map
AA seq 190 aa AA seqDB search
MVKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQ
CGALSENELCEICSDKERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGVNLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaggcctggaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgccataaggcttgcttatcacctttgcataaataatcaaatcgat
ggtatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgagcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgataaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagcattaat
tctgatgcaaccatcttttttatagaggataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtgtaaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system