KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_06565Help
Entry
A911_06565        CDS       T02264                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cjp00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:cjp00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cjp00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1282354..1283343
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLSLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSQA
TQTQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGVNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYEHSSPFRETNYQPEFFIDLPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPENKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHNNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaagcttatgcgtttttatatgggctagtgatttacaa
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaataactcaagtcaagca
acacaaacgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagctttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggagtaaataataat
aagagtgaggcgaaattccaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttatgagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagatcttcctttatat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctactgctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaaacaaaaaa
gatgatgataatcctgccatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttaggtgatgattattttatcaatcttatgctaagaaataatcttaaattccacaataac
aaaggcgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttgcaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system