KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_06705Help
Entry
A911_06705        CDS       T02264                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Brite
Enzymes [BR:cjp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     A911_06705
Secretion system [BR:cjp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   A911_06705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1318981..1319691
Genome map
AA seq 236 aa AA seqDB search
MKKLSLILVCSASLFAASNSEISDFYSKSIKAQFPNATVSVSNRQKVGNTGFESVIVSVE
LNGQKQENILFTKDSLITPDLIDLKTGISYAQEYEMKKFQEARENFTKNAKAVAQKETMV
IALGDKNKPAIYVFSDPECPYCREHLAQIDDELKNYQVNYILTPVHGKSAFEKSALIYKE
AKKAKNDKEKIAILNKYYDANIKNYPKVSDAELKEVFSLYEKYRSLGLSATPTIIK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaagtttaattcttgtctgttcagcatctttgtttgctgcaagtaattca
gaaattagtgatttttattcaaaaagcattaaagcacaatttccaaatgctaccgttagt
gtatcaaatcgtcaaaaggttggtaatacgggttttgaaagtgttattgtaagcgttgaa
ttaaatggacaaaaacaagaaaacattctttttacaaaagatagtcttattacccctgat
cttatcgacttgaaaacgggaatttcttatgctcaagaatatgaaatgaaaaaatttcaa
gaagcaagagaaaattttacaaaaaatgctaaagctgtagcacaaaaagaaaccatggta
atagctttgggagataaaaataaacctgcaatttatgttttttcagatcctgaatgccct
tattgtagagaacatttagctcaaattgatgatgaacttaaaaactatcaagttaattat
attttaactccagtacatggaaaatctgcttttgaaaaatccgctctaatctacaaggaa
gcaaaaaaagcaaaaaatgataaagaaaaaatcgcaattttaaacaaatactatgatgca
aatatcaaaaattatccaaaagtaagtgatgcagaattaaaagaagttttttccttatat
gaaaaatatcgctcattaggtcttagcgctactccaactattattaaataa

DBGET integrated database retrieval system