KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_07395Help
Entry
A911_07395        CDS       T02264                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjp00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A911_07395
   00052 Galactose metabolism
    A911_07395
   00500 Starch and sucrose metabolism
    A911_07395
   00520 Amino sugar and nucleotide sugar metabolism
    A911_07395
Enzymes [BR:cjp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     A911_07395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1460862..1461686)
Genome map
AA seq 274 aa AA seqDB search
MLQTCIFPAAGYGTRFLPATKTLPKEMLPILTKPLIHYGVDEALEAGMENMGFVTGRGKR
ALEDYFDISYELEHQISGTKKEYLLDEIRSLINRCTFTFTRQNQMKGLGDAVLKGRPLVG
DEAFGVILADDLCVNEEGLNVMAQMVKIYEKYRCTIIAVMEVPKEQVSNYGVISGNFVEE
NLIMVNSMIEKPSPDEAPSNLAIIGRYILTPDIFGILENTKAGKNGEIQLTDALLTQATN
GMVLAYKFQGKRFDCGSVEGFVEATNYFYEKSKC
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaacttgtattttccctgcggcaggttatgggacgagatttttacctgcaaca
aaaactttacctaaagagatgttacctatcttaaccaagcctttgatccattatggagtt
gatgaagctttagaagcaggaatggaaaatatgggatttgtcacagggcgtggaaaaaga
gctttggaggattattttgatatttcttatgaacttgaacatcaaatttcaggtacaaaa
aaagaatacttacttgatgaaattcgctctttgatcaatcgttgtacctttacttttaca
agacaaaatcaaatgaaaggcttaggtgatgcggttttaaaaggtagacctttggttggc
gatgaagcttttggcgtaattttggctgatgatttgtgtgttaatgaagaaggcttaaat
gttatggctcaaatggtaaaaatttatgaaaaatatcgctgcaccatcatagctgtgatg
gaagtaccaaaagagcaagtttcaaactatggagtaatttctggaaattttgtagaagaa
aatcttatcatggttaattctatgatagaaaaaccaagtcctgatgaagctccaagtaat
cttgctatcataggaagatatattttaactcctgatatttttggaattttagaaaatact
aaagcaggaaaaaatggtgaaattcaacttaccgacgcgcttttaactcaagcaaccaat
ggtatggttttagcttataaatttcaagggaaacgctttgattgtggaagtgtagaaggc
tttgtagaggcgacaaattatttttacgagaaaagtaaatgttaa

DBGET integrated database retrieval system