KEGG   Campylobacter jejuni subsp. jejuni PT14: A911_07400Help
Entry
A911_07400        CDS       T02264                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
cjp  Campylobacter jejuni subsp. jejuni PT14
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:cjp01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cjp00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cjp00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cjp00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:cjp00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1461768..1463741)
Genome map
AA seq 657 aa AA seqDB search
MLNQNNQELFKPSKEFSRNARIKNLCEYYDLCDEAKEDFEGFWKRQAFEKIEWFSPFSRV
LNEDKAPFYKWFEGGTLNVSYQCLDRHMKTRRNKAALIFEGEMGDYEVYTYRRLLHETCK
AANLLKKFGVKKGDRVVIYMPMIPETAIVMLACARIGAIHSVVFGGFSPEALRDRIIDAG
AKLVVTADGAFRRGKPYMLKPAVDKALSEGCESVEKVLIVIRNNEPIEYIKGRDYVYNEL
VKNESYKCEPEIMDSEDLLFLLYTSGSTGKPKGVMHASAGYILWAQMTMEWVFDIKDYDN
YWCSADVGWITGHTYVVYGPLACGATTIMHEGTPTYPNSGRWWRMIEEYQISKFYTSPTA
IRMLHADAPNEPRKYDLSTLEVLGTVGEPINPSAWKWFYDEIGGTKSPIVDTWWQTETGG
HMITPLPGATPLKPGCATLPLPGIFAEVIDEEGNKKDEGEDGLLCITKPWPSMIRGIWGN
DERYIESYFSQAKKDGKAVYFSGDGAFYDKNGYITITGRTDDVVNVAGHRIGTAEIESAI
AKHPSVAESAVVSILDTIKGESLFAFVVLSPASSCDLGGAIETLKELNDILRVEIGPIAK
IEKILYTPGLPKTRSGKIMRRILRTIARGEEIKQDISTLEDSKVVETIVKLTKAEFE
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaaaataatcaagagctttttaagccaagtaaagaattttctcgtaatgct
cgtataaaaaatttatgtgaatactatgatttatgcgatgaagccaaggaagattttgaa
ggtttttggaaaagacaagcatttgagaagattgagtggttttcgcctttttcaagagtg
ctaaatgaggataaagctccattttataaatggtttgaaggtggaactttaaatgtaagt
tatcaatgtcttgatcgtcatatgaaaacaagacgcaataaagctgctttgatttttgaa
ggtgaaatgggggattatgaagtttatacttatagaagattattgcatgaaacttgcaag
gcggccaatttgcttaaaaaattcggagtaaaaaaaggcgatagggttgtaatttatatg
cctatgattccagaaacagctatagtaatgttagcttgtgcaaggattggggctattcat
agtgtagtatttggagggttttctcctgaagccttaagagatagaattatagatgcagga
gctaaacttgtagtaacggctgatggtgcttttcgtcgtggcaaaccttatatgttaaaa
cctgcagtagataaggctttaagtgaagggtgtgaaagtgtagaaaaagtacttatagtt
atacgcaataatgagcctatagaatatattaaaggaagggactatgtttataacgaactt
gtgaaaaatgagtcttataagtgtgaacccgaaattatggatagtgaggatttgttgttt
ttgctttacacttcaggatcaacgggcaagccaaaaggagttatgcatgcaagtgcagga
tatatactttgggcacaaatgactatggaatgggtttttgatattaaagattatgataat
tattggtgtagtgctgatgtgggttggattacaggacatacttatgtagtttatgggcct
ttagcatgtggggcaacgactataatgcatgaaggaactcctacttatccaaattctggg
cgttggtggagaatgatagaagagtatcaaataagcaaattctacacttcgccaactgcc
ataagaatgcttcatgctgatgcacctaatgagccaagaaaatatgatttaagtacgctt
gaagtgcttggaacggttggagagcctatcaatcctagtgcttggaagtggttttatgat
gaaatagggggaactaaaagtcctatagtcgatacttggtggcaaacagaaacaggtggg
catatgatcacgcctttaccaggcgccactcctttaaaaccaggttgtgccaccttgcct
ttgccagggatttttgcggaagttattgatgaagaaggcaataaaaaagatgaaggtgaa
gatgggttgctttgtataactaaaccttggccttcgatgattcgtggaatttggggcaat
gatgaacgctatatagaaagttatttttctcaagctaaaaaagatggaaaagctgtatat
tttagtggcgatggtgctttttatgataaaaatggttatattaccatcacaggaagaaca
gatgatgtggttaatgttgcaggacatcgtataggaacggctgaaattgaaagcgctatt
gctaaacatccaagtgtagcagaatcagctgtagtgagtattttggatacgattaagggc
gagtcattgtttgcttttgtggttttaagtcctgcatccagttgtgatcttggcggagct
atagaaactttaaaagaacttaatgacattttaagagtagaaataggacctatagctaaa
atagaaaaaattctttatactccaggtttgccaaaaactagaagtggtaaaataatgaga
agaattttaagaactatagcaagaggcgaagaaatcaaacaggatatttcaacacttgaa
gattctaaagtagtagaaaccattgttaaattaactaaggcagagtttgaataa

DBGET integrated database retrieval system