KEGG   Campylobacter jejuni RM1221: CJE0020Help
Entry
CJE0020           CDS       T00227                                 

Gene name
ccpA-1
Definition
cytochrome C551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cjr  Campylobacter jejuni RM1221
Brite
Enzymes [BR:cjr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     CJE0020 (ccpA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(23564..24478)
Genome map
AA seq 304 aa AA seqDB search
MKKIIMILCLSYANIVFAVDMITPIPNSISYDKEKAKLGKSLYMDKSLSKDGKVSCNTCH
RLDQHGVDGLEFSIGVDNQLDKPFNTPTTFNSVFNFVQFWNGRAKDLTEQAMGPFFNPKE
MGLSPELLLQKVNSNENYVKTFKKLYGEVTVENIALAIAEFEKTLITPNSPFDRYLSGDQ
NAISTQAKKGYEDFKANGCISCHQGQNIGGNMFQKIGIFEEYPNQEDLGRYEITKREADK
MVFKVPSLRNIAKTAPYFHDGSIPTLDACVQFMAYYQLGKFLDQETVDNIVAFLESLTGE
YHDK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataataatgattttatgtttatcttatgcaaatatagtctttgcagtagat
atgataacccctattccaaattccatctcttatgataaagaaaaagctaaacttggaaaa
agtctttatatggataaaagtttatccaaagatggaaaagtttcgtgcaatacttgccat
aggcttgatcaacacggtgttgatgggcttgaattttcaataggagttgataatcaactc
gataaaccctttaacactcctacaacctttaattctgtgtttaattttgtgcaattttgg
aatggcagagctaaagatttaacagaacaagctatgggaccttttttcaatccaaaagaa
atggggctaagtcctgaacttcttttacaaaaagttaattcaaatgaaaattatgtaaaa
acttttaaaaaactttatggagaagttacggtagaaaacatagctcttgcaatcgccgaa
tttgaaaaaaccttgatcactccaaattctccttttgatcgctatcttagcggggatcaa
aatgctatttcaactcaagctaaaaaaggttacgaagattttaaagctaatggctgcatc
tcttgtcatcaaggtcaaaatataggtgggaatatgtttcaaaaaatcggtatttttgaa
gaatacccaaaccaagaagatttagggcgctatgaaatcacaaaaagagaagctgataaa
atggtatttaaagttcctagtcttagaaatatagccaaaaccgcgccttattttcatgat
ggttctatacctactttagatgcttgtgttcagtttatggcttactatcaactaggaaaa
tttttagatcaagaaacagttgacaatatagttgcattcttagaaagcttaacaggagaa
tatcatgacaaataa

DBGET integrated database retrieval system