KEGG   Campylobacter jejuni RM1221: CJE0062Help
Entry
CJE0062           CDS       T00227                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJE0062 (folK)
Enzymes [BR:cjr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     CJE0062 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(77786..78259)
Genome map
AA seq 157 aa AA seqDB search
MLKIQGVKHFEKSRFFPFFSQNIRSFKYLALIGLGSNIEPEKKRFDMLFRVMMDDKRFKI
LSTSPMLINEAFGFKEQKDFTNAVMLIQTNLHARALLKVLLYYEVKFKRKRTFKNAPRTL
DLDLLYFSQKVKRDKWCEVPHKGAKERVSVILPLGMI
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaattcaaggagtaaaacactttgaaaaaagtcgtttttttcctttttttagt
caaaatatacgatcttttaaatatttagctcttataggcttaggaagcaatatagagccc
gaaaaaaaaagatttgatatgctttttcgagtaatgatggatgataaaagatttaaaatt
ttatccacatctcctatgttgataaatgaagcctttggttttaaagagcaaaaagatttt
accaatgctgttatgttgatacaaactaatttgcatgcacgagcacttttgaaagtttta
ctttattatgaagtaaaatttaaacgcaagagaactttcaaaaacgctcctagaacgctt
gatttagatcttttatacttttcacaaaaagtcaagcgtgataagtggtgtgaggtgcct
cataaaggggctaaagaaagagtgagtgtaattttgcctttaggcatgatataa

DBGET integrated database retrieval system