KEGG   Campylobacter jejuni RM1221: CJE0187Help
Entry
CJE0187           CDS       T00227                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJE0187 (folE)
Enzymes [BR:cjr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CJE0187 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187625..188197
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTILEIIGENPNREGLIKTPNRVFKAYEFLASGYTQNVKDILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGIQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaaccatacttgaaattataggagaaaatcca
aatcgtgaagggcttattaaaacaccaaatcgtgtttttaaagcttatgaatttcttgct
agtggttatacgcaaaatgtcaaagacattttaaatgatgctttatttgaaagctctaat
aatgaaatggttttggtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatatccctaataaaaaagtagtaggtttaagc
aaaattccacgccttgtagaagtgtttgcaagaagacttcaaattcaagaacaacttact
gaacaaatcgcacaagctttaatggaaaatgttgatgcaaaaggtgtgggtgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggaatacaaaaagctaattccaccactaca
acttcagctttacgtggaattttcttaaaaaatgaaaaaaccagagaggaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system