KEGG   Campylobacter jejuni RM1221: CJE0398Help
Entry
CJE0398           CDS       T00227                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00260  Glycine, serine and threonine metabolism
cjr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01130  Biosynthesis of antibiotics
cjr01230  Biosynthesis of amino acids
Module
cjr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJE0398 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJE0398 (trpA)
Enzymes [BR:cjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CJE0398 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB PucR IGPS FMN_dh
Motif
Other DBs
NCBI-ProteinID: AAW34987
UniProt: Q5HWB8
Structure
PDB: 

Jmol
Position
357686..358435
Genome map
AA seq 249 aa AA seqDB search
MVDFRKFYKENANVAYTVLGYPNLQTSEAFLQRLDQSPIDILELGVAYSDPIADGEIIAD
AAKIALDQGVDIHSVFELLARIKTKKALVFMVYYNLIFSYGLEKFVKKAKSLGICALIVP
ELSFEESDDLIKECERYNIALITLVSVTTPKERVKKLVKHAKGFIYLLASIGITGTKSVE
EAILQDKVKEIRSFTNLPIFVGFGIQNNQDVKRMRKVADGVIVGTSIVKCFKQGNLDIIM
KDIEEIFKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggttgattttagaaaattttataaagaaaatgcaaatgtggcttatacggttttaggt
tatccaaatcttcaaacaagtgaagcttttttgcaaagattggatcaaagccctattgat
attttagaacttggtgttgcttatagtgatcctattgccgatggtgagattattgcagat
gcggcaaaaatagctcttgatcaaggcgtggatattcatagtgtttttgagcttttagct
aggataaaaactaaaaaagctttggtttttatggtttattataatttaattttttcttat
ggcttggaaaaatttgtgaaaaaagcaaaatctttagggatttgtgctttgattgtgcct
gaattgagttttgaagaaagtgatgatttaattaaagagtgtgaaagatataatatagct
ttaattacacttgtaagtgttacaacccctaaagaaagggttaaaaagttagtaaaacat
gctaaaggttttatttatttattagcaagcataggtattacaggtacgaaaagtgtcgaa
gaagcaatcttacaagataaagtaaaagaaatcagatcttttacaaatttgcctattttt
gtaggctttggcattcaaaataatcaagatgtaaaaagaatgagaaaagttgctgacgga
gtgattgtgggaactagcatagtaaagtgttttaaacaaggaaatttggatataataatg
aaagatattgaagaaattttcaaaaaataa

DBGET integrated database retrieval system