KEGG   Campylobacter jejuni RM1221: CJE0430Help
Entry
CJE0430           CDS       T00227                                 

Gene name
pyrF
Definition
orotidine 5'-phosphate decarboxylase (EC:4.1.1.23)
Orthology
K01591  
orotidine-5'-phosphate decarboxylase [EC:4.1.1.23]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cjr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(385591..386430)
Genome map
AA seq 279 aa AA seqDB search
MKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIEELKKVDDFKIFLDLK
IHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTRLSKFSKRPLVLAVSALTSFD
EENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFG
ETSDDQKRVANLAMARENLSDYIVVGRPIYKNENPRAVCEKILNKIHRKNISENDIEQNY
EVIQQKEWDMCNHFEEWIKTQPDKEHALKEFYAKCGIKY
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttgtgtcgcacttgatctttctacaaaagaagaatgcttacaacttgccaaa
gaattaaaaaatttagacatatggttaaaagtaggtttaagagcatatttaagagatggt
tttaaattcatagaagaacttaaaaaagttgatgattttaaaatatttcttgatcttaaa
attcatgatattcccaacactatggcagatgcttgcgaagaagtatcaaaacttggtgtt
gatatgatcaatatccacgcaagtgctggaaaaatagccatacaagaagttatgacacgg
cttagcaaattttcaaaaagacctttagttttagcagtttctgctcttacgagttttgat
gaagaaaatttctttagtatttatagacaaaaaattgaagaagctgtaattaatttttca
aaaatatcctatgaaaatggacttgatggtatggtatgctctgtttttgaaagcaaaaaa
attaaagagcacacaagttcaaatttcttaacccttactcctggaattcgtccttttgga
gaaacaagtgatgatcaaaaacgtgttgctaatcttgcaatggctagagaaaatttgagt
gattatatcgttgtgggaaggcctatatataaaaatgaaaatcctagggctgtatgtgaa
aaaattttaaacaaaatacacagaaaaaatataagcgaaaacgatatagagcaaaattat
gaagtaattcagcaaaaagaatgggatatgtgtaatcactttgaagaatggattaaaact
cagcctgataaagaacatgctttaaaagaattttatgctaagtgtgggataaaatattga

DBGET integrated database retrieval system