KEGG   Campylobacter jejuni RM1221: CJE0606Help
Entry
CJE0606           CDS       T00227                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01130  Biosynthesis of antibiotics
cjr01230  Biosynthesis of amino acids
Module
cjr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJE0606 (trpC)
Enzymes [BR:cjr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CJE0606 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C AEP1
Motif
Other DBs
NCBI-ProteinID: AAW35880
UniProt: Q5HVR3
Structure
PDB: 

Jmol
Position
541255..542031
Genome map
AA seq 258 aa AA seqDB search
MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALKRVEKEVKIIAEVKKA
SPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYLSLIRRYTQIPLLRKDF
IFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLEALVEIHDKEDLSKAIFA
GADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLENKEFLEHLQNLGVDAFLI
GEYFMREKDEGKALKALL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaatttttgaaaaaacaaaagaagatttaaaagaacgcaaactaaaa
cttccttatgatatgttagggcgttctttagcttcaaatcctttctttccaaaagatgtg
attaaggctttaaaaagagtagaaaaagaagttaaaatcatagcagaagtaaaaaaagca
agccctagcaagggagtcattagagaagactttgatcctttgagtatcgctttaaattat
gagaagaacaaagctgcggcgatttctgttttaactgagccgcatttttttaaaggttct
ttagaatacttaagtcttatacgccgttatacgcaaattcctttacttagaaaagatttt
atctttgatgagtatcaaattttagaagctttggtttatggggcggattttgtattatta
atcgctaaaatgctaagcatgaaagagcttaaaaaactgcttgagtttgcaagacattta
ggtcttgaggctttggttgaaattcatgataaagaggatttgagtaaggctatttttgct
ggagcggatatcattggtatcaatcatcgtaatttagaggattttactatggatatgagt
ttgtgcgaaaaacttatcccacaaatcccaaattcaaaaatcatcatcgcagaaagtggt
ttagaaaataaagaatttttagagcatttgcaaaatttaggcgttgatgcttttttaatc
ggcgaatattttatgcgcgaaaaagatgaaggaaaggctttaaaagctttgctttaa

DBGET integrated database retrieval system