KEGG   Campylobacter jejuni RM1221: CJE0637Help
Entry
CJE0637           CDS       T00227                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr00020  Citrate cycle (TCA cycle)
cjr00640  Propanoate metabolism
cjr00660  C5-Branched dibasic acid metabolism
cjr01100  Metabolic pathways
cjr01110  Biosynthesis of secondary metabolites
cjr01120  Microbial metabolism in diverse environments
cjr01130  Biosynthesis of antibiotics
cjr01200  Carbon metabolism
Module
cjr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CJE0637 (sucC)
   00640 Propanoate metabolism
    CJE0637 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CJE0637 (sucC)
Enzymes [BR:cjr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CJE0637 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A DUF1983 Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AAW35850
UniProt: Q5HVN3
Position
575622..576785
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKAIFVDNGIPTLKGKVAFSVDEAVANAKELGGSVWAVKAQIHAGGRGLGGGV
KIAKNLDEVKDYASKILGMNLVTHQTGPEGKLVQKLYIESGANIVKEYYLAILFNRMAEQ
ITIIASSEGGMDIEKVAKESPEKIAKVGIDPQIGFKMFHGLEVARVLGLDKDEGKKLISM
IAKLYKLYMDKDMNMLEINPLIKTAEGDFYALDAKCSFDDSALYRHPEIAELRDTTEENP
AEREAAEFGLSYVKLDGDVACMVNGAGLAMATMDIINYSGAKPANFLDVGGGASPETVAK
AFEIILRDKNVKVIFINIFGGIVRCDRIANGILEATKNVEVNIPIVVRLDGTNAAEAKTI
LDNSNLKNIKAATNLKNGAELVKSLVG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacatgagtatcaagcaaaagcaatttttgtagacaatggcatccctacctta
aagggaaaagttgcatttagcgtagatgaagctgtggctaatgctaaagaattaggcggt
agtgtttgggcagttaaagctcaaattcatgcaggaggccgtggtcttggtggtggtgtt
aaaatcgctaagaatttagatgaggtaaaagattatgcaagtaaaattttaggaatgaat
ttagtaactcatcaaacaggacctgaaggcaaacttgtgcaaaaactttatatagaaagt
ggtgctaatatagtaaaagagtattatttggctattttgtttaatagaatggcagagcaa
attaccattatcgcttcaagtgaaggagggatggatatagaaaaagtagccaaagaaagt
cctgaaaaaattgcaaaagtaggtattgatccacaaattggatttaaaatgtttcatgga
cttgaagtagcgagagttttgggacttgataaagatgaaggcaaaaaactcatttctatg
atagctaaactttataagctttacatggataaagatatgaatatgcttgaaattaatcct
ttaattaaaactgcagaaggggatttttatgcccttgatgcaaaatgcagttttgatgat
agtgcgctttatcgtcatcctgaaattgctgaacttagagatactactgaagaaaatcct
gctgaaagagaagcggctgaatttggcttaagctatgtgaaattagatggagatgtagct
tgtatggtaaatggtgcgggtctagcaatggcaactatggatattattaattatagtggt
gcaaaacctgcaaatttcttagatgtaggtgggggagcttctccagaaactgttgcaaag
gcttttgaaattattttaagagataaaaatgtaaaagttatatttatcaatatctttggt
ggtattgttcgttgtgataggatagcaaatggaattttagaagctactaagaatgttgag
gtaaatattccaattgtagtgcgtcttgatggcactaacgcagcagaagcaaagacaatt
ttagataattcaaatcttaaaaatatcaaagcagcaaccaatcttaaaaacggtgcagag
cttgtaaaaagtttagtaggataa

DBGET integrated database retrieval system