KEGG   Campylobacter jejuni RM1221: CJE0890Help
Entry
CJE0890           CDS       T00227                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJE0890 (ruvA)
Enzymes [BR:cjr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CJE0890 (ruvA)
DNA repair and recombination proteins [BR:cjr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CJE0890 (ruvA)
    RecFOR pathway proteins
     CJE0890 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(827771..828322)
Genome map
AA seq 183 aa AA seqDB search
MVVGIEGIITKKEPTFIIVKCASGLSYGIFISLFCSAKIQTQEKHEFFITQIIKEDSNKF
YGFLDKDEQKMFEMLLKVNGVGANTAMAVCSSLDVNSFYKALSLGDESVLKKVPGIGPKS
AKRIIVELSDTKTKLENVSDDKSEALAALLTLGFKQEKIISVLASAQATGTSELIKEALK
KLG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcggcatcgaaggaataatcacaaaaaaagaacctacttttatcattgttaaa
tgtgctagtggtttaagctatgggatatttatttcgcttttttgttctgctaaaattcaa
actcaagaaaagcatgagttttttattactcaaatcatcaaagaagattctaataaattt
tatggcttcttggataaagatgaacaaaaaatgtttgaaatgcttttaaaagtcaatgga
gtgggtgcaaatactgctatggcggtatgctctagtcttgatgtaaattctttttacaaa
gcgttaagtttaggcgatgaaagcgtgcttaaaaaagtacctggtataggtccaaaaagt
gcgaaacgcattatagtagaactttcagatacaaaaaccaaacttgaaaatgtaagcgat
gataaaagtgaagccttagccgcacttcttactctaggctttaaacaagaaaaaatcata
agtgttttagcaagtgctcaagcaacaggcacaagcgaactcatcaaagaagctcttaaa
aaactaggataa

DBGET integrated database retrieval system