KEGG   Campylobacter jejuni RM1221: CJE0903Help
Entry
CJE0903           CDS       T00227                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CJE0903 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJE0903 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CJE0903 (thrC)
Enzymes [BR:cjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CJE0903 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
841535..842947
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNKIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNVNNILSEFFNHGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILALFDLKNSDEKVFEAKNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagtcgagagtagaaatgtaaataatgtatcaagttttaaggaagctttgatt
aacccaaacgccccagaaggagggctttactcgcctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
gggcctacaagagcttttaaagatatggctttacagccttttggcgtgcttttaagcgaa
ttttcaaaggataaaaatattttaattatttgtgctacgagcggcgatacaggacctgca
accctaaaaagctttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataatttgaaagtt
tttgctatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaacaaaattaaagctttaaattatgagctttgcgcagcgaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcattgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaat
gtgaataatattttgagtgaattttttaatcatggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaaccaaagaactgatgaatttgttgaaaaatgag
agatattttaaacttgaaaaagaagaattgcaaagtttacaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagcaagattttaatcgatccg
cacaccgcaacttgttttaaaatgcttgatcctttaaaacctagcattattacctctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatacgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttggctttatttgacttgaaaaatagcgatgaaaaggtatttgaagccaaaaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system