KEGG   Campylobacter jejuni RM1221: CJE1002Help
Entry
CJE1002           CDS       T00227                                 

Gene name
cheB
Definition
chemotaxis protein CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cjr02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cjr02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(937753..938307)
Genome map
AA seq 184 aa AA seqDB search
MKLILIGSSTGGPNQLKFLLKDIDVKNTCVVIAQHMSASFIPSFVGQFNKEAFSEVCLLN
DKEILSNKIYICPKNTILSGNLNIVAAWQDVASSFKPSVDLLFHSAVSLAKTNKILAIIL
TGMGDDGAKGLFELYKTGVRCLCENEADSVVYGMPKRAKDMNPHLKPMSLKEIKKEIVNF
IDQD
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcatactcataggatcttcaacaggtggtcctaatcagcttaaatttctttta
aaggatattgatgtaaaaaatacttgtgtagttatagctcagcacatgagtgccagtttt
attccatcttttgtggggcaatttaataaagaagcttttagtgaagtgtgcttattgaac
gataaagagatattaagcaataaaatttatatttgccctaaaaatactattttatctgga
aatttaaatattgtagccgcttggcaagatgtggcttcaagctttaaaccgagtgtggat
ttactttttcattccgctgtttctttggcaaaaacaaataaaatacttgctattatttta
acgggcatgggagatgatggcgcaaaaggtttatttgagctttataaaacaggagttaga
tgtttatgtgagaatgaagcagatagcgtcgtttatggtatgccaaaaagagcaaaagat
atgaatccgcatttaaaacctatgagcttaaaagaaattaaaaaagaaattgtaaatttt
attgatcaggattaa

DBGET integrated database retrieval system