KEGG   Campylobacter jejuni RM1221: CJE1075Help
Entry
CJE1075           CDS       T00227                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CJE1075 (hemB)
Enzymes [BR:cjr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     CJE1075 (hemB)
Exosome [BR:cjr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CJE1075 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1003657..1004640)
Genome map
AA seq 327 aa AA seqDB search
MFKRFRRLRLNENLRSMVRENSLSVNDLIYPLFVVNGTGIKKEISSMPDVFQMSLDEILK
ECQNVVNLGIKAIILFGVLENEKKDSCGSDALDDEGLVARSIREIKKNFPDLFIISDLCF
CEYTDHGHCGIIDPKTKSVDNDATLEISAKQALVHARAGVDMIAPSGMMDGVITTLRKAL
DKEGFENLPIMAYSTKFASSYYGPFRDVAESAPSYGDRKSYQMDFANGKEALEESLEDEA
QGADILMVKPALAYLDVVKEISLHSNLPLCVYNVSGEYAMLKAAKNAGVIDYEKVLYETM
IAFKRAGAKLIITYHAKELAKMLKGEK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagatttagaagattaaggcttaatgaaaacttaagatctatggtaagggaa
aattctttaagtgtaaatgatttgatttatccgctttttgtggttaatggaacggggata
aaaaaagaaatttcttctatgcctgatgtgtttcaaatgagtttagatgaaattttaaaa
gagtgtcaaaatgtagttaatttaggcattaaagccattatactttttggtgttttagaa
aatgagaaaaaagacagttgcggaagcgatgctttagatgatgaagggcttgttgcaaga
agtataagagagattaagaaaaattttccagatctttttataatcagtgatctttgtttt
tgcgaatacacagatcacgggcattgtgggattatcgatccaaaaacaaaaagcgtagat
aatgatgcaactttagaaatttcagccaagcaagccttagttcatgcaagagcaggggta
gatatgatagcacctagtggaatgatggatggtgttatcactactttgcgcaaagcttta
gataaagaaggttttgaaaatttgcctataatggcgtattctactaaatttgcttcaagt
tattatgggccatttcgagatgtagcagaatcagctccaagttatggagatagaaaaagc
tatcaaatggattttgctaatggtaaagaagctttagaagaaagcttggaagatgaagca
caaggagctgatattttgatggtaaaacccgctcttgcttatcttgatgtggttaaagaa
atatcccttcattctaacttgcctttgtgtgtttataatgtaagcggagagtatgctatg
ttaaaggcagctaaaaatgcaggagtgattgattatgaaaaagttttgtatgaaactatg
atagcttttaaaagagcaggggcaaagcttatcatcacttatcatgccaaagaattagct
aaaatgttaaaaggagaaaaatga

DBGET integrated database retrieval system