KEGG   Campylobacter jejuni RM1221: CJE1241Help
Entry
CJE1241           CDS       T00227                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cjr00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cjr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1158534..1159421
Genome map
AA seq 295 aa AA seqDB search
MRHLITTKDFNKVEIMELFKEASDFLDEKPRTFLEGKSITTIFFENSTRTLSSFESAARR
LGARVLRLDVSRSSSSKGETLYDTAANLDAMSPNAIVVRHANSGVPLILAKHMHCPVVNG
GDGKHAHPTQALLDLFTIYNHFQGNVEGKKICIVGDIKNSRVAASNIELLSRFNLDITLV
APPHFMPNTHLKKHYKLDENIIANSDIIMSLRTQTERHNKTVYASLKDYANDFCIQKSLA
KDKKLILLHPGPVNRNIDISDEMMSDERTLVLKQVKNGVAIRMAVLKKLILENEG
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcactacaaaggattttaataaagtcgaaattatggagctttttaaa
gaagcaagtgatttcttagatgaaaaacctaggacttttcttgaaggaaaaagcatcacg
acaattttttttgaaaactctacacgcaccctttcatcttttgaaagcgctgcaagaaga
ttaggtgctagggttttacgccttgatgtttcaagatcaagctctagcaaaggagaaact
ctttatgatactgctgctaatttagatgccatgagtcctaatgctattgttgtaagacac
gcaaactcaggagttcctttgatattagcaaagcatatgcattgtccagttgttaatgga
ggagatggaaaacacgcccatcctacccaagctttactcgatttgtttacgatttataat
cattttcaaggtaatgttgaaggtaagaaaatttgcatcgtaggtgatattaaaaactct
cgtgtagcagcgtccaatatagagcttttaagtagatttaatcttgatattaccctagta
gctccaccacattttatgcctaatacccatcttaaaaaacattataagcttgatgagaat
atcatagcaaattcagatattatcatgagtcttagaacacaaacagaaagacataataaa
accgtttatgcttcacttaaagactatgcaaatgatttttgcattcaaaaaagcttagca
aaagataaaaagcttattttactacatccaggccctgtaaatcgcaatattgacataagc
gatgaaatgatgagcgatgaaaggactttagttttaaaacaagttaaaaatggagtggcc
attagaatggctgttcttaaaaaactcatattagaaaatgaaggataa

DBGET integrated database retrieval system