KEGG   Campylobacter jejuni RM1221: CJE1399Help
Entry
CJE1399           CDS       T00227                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
cjr  Campylobacter jejuni RM1221
Pathway
cjr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CJE1399 (recR)
DNA repair and recombination proteins [BR:cjr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     CJE1399 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      CJE1399 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RecR Toprim_4 zn-ribbon_14 Ras_bdg_2
Motif
Other DBs
NCBI-ProteinID: AAW35718
UniProt: Q5HTK0
Position
1314275..1314847
Genome map
AA seq 190 aa AA seqDB search
MVKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQ
CGALSENELCEICSDEERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGINLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaggcctggaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgccataaggcttgcttatcacctttgcataaataatcaaatcgat
ggtatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgagcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgatgaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagtattaat
tctgatgcaaccatcttttttatagaggataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtataaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system