KEGG   Campylobacter jejuni RM1221: CJE1399Help
Entry
CJE1399           CDS       T00227                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cjr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1314275..1314847
Genome map
AA seq 190 aa AA seqDB search
MVKGLEKFNELVESFANLPTIGKKTAIRLAYHLCINNQIDGMKLAHNIENAIRFIKPCEQ
CGALSENELCEICSDEERNKNILCIVESPKDILTLEESQSYNGLYFVLDELNEEKLEKLK
QIILKLNISELIFALTHSINSDATIFFIEDKFKGLNLTFSKIAQGIPSGINLENVDLISL
NKAMNFRTKI
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaggcctggaaaaattcaatgaacttgttgaaagttttgcaaatttacctacc
ataggaaaaaaaaccgccataaggcttgcttatcacctttgcataaataatcaaatcgat
ggtatgaaactcgcacacaatatagaaaatgctatccgctttataaaaccttgtgagcaa
tgcggtgctttaagcgaaaatgagctttgcgaaatttgtagcgatgaagaaagaaataaa
aacattttatgtatagttgaaagcccaaaagatatactaacactcgaagagagtcaaagt
tacaatgggctatattttgttttagatgagttaaatgaagaaaaacttgaaaaactaaag
caaatcatacttaagctaaatatctctgagctcatttttgcattgacacatagtattaat
tctgatgcaaccatcttttttatagaggataaatttaaaggcttaaacctaacttttagt
aaaatcgctcaaggaattccaagtggtataaatttagaaaatgtggatttaatctcttta
aataaagctatgaattttagaacaaaaatttag

DBGET integrated database retrieval system