KEGG   Campylobacter jejuni RM1221: CJE1414Help
Entry
CJE1414           CDS       T00227                                 

Gene name
trmB
Definition
(GenBank) tRNA (guanine-N(7)-)-methyltransferase
  KO
K03439  
tRNA (guanine-N7-)-methyltransferase [EC:2.1.1.33]
Organism
cjr  Campylobacter jejuni RM1221
Brite
Enzymes [BR:cjr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.33  tRNA (guanine46-N7)-methyltransferase
     CJE1414 (trmB)
Transfer RNA biogenesis [BR:cjr03016]
 Eukaryotic Type
  tRNA modification factors
   Methyltransferases
    CJE1414 (trmB)
 Prokaryotic Type
    CJE1414 (trmB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1331083..1332261)
Genome map
AA seq 392 aa AA seqDB search
MPNFKSKKIKEINLPYSKDDVEFLWLAKNDNVSLIYTKVQEESFFLQIKKAQNGFVIKGD
KHTKPSKIGYLQKALKIFKEGFCEDIINEAFGLKNNALIEKTPFIVDNFDELLSRLQGKI
YIEIGFGSGRHLLYQAKENPNVLILGVEIYNPALTQVAKLAKAQNVNNILLIQSDARLLL
SVLKSKSVEKIFLHFPVPWDKKPHRRVIGKDFCKECARVLTQNGRFELRTDSFEYFNFTL
EQFLTFPVPKFSLRKNENLEISSKYEDRWKKQEKNIYDLWVWNFNQECKNYELNEFNLSS
VEFSKEDLKKIEQNFKNITIKKDDFFLHFESIYKQDENLLLKVAFGAFNKPEHCYLHLDK
TIDFAFKEPFKIQENIKAINELKEILKVQFKI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgccaaattttaaaagtaaaaagatcaaagaaataaatctgccttatagtaaggatgat
gttgaatttctttggcttgctaagaatgataatgttagtcttatttatacaaaggttcaa
gaagagagtttttttctgcagattaaaaaagcacaaaatggttttgtgattaaaggcgat
aaacatacaaaaccttctaaaataggttatttgcaaaaggctttaaaaatctttaaagaa
ggtttttgtgaggatattatcaatgaagcttttggacttaaaaacaatgctttaattgaa
aaaacaccatttatcgttgacaattttgatgagcttttgtctaggcttcaaggtaaaatt
tatatagaaataggctttggatcaggaagacatttgctttatcaagcaaaagaaaatcca
aatgttttaattttaggggtggaaatttacaacccagctttaactcaagtggctaaactt
gctaaagcacaaaatgtaaataatattttgctaatccaaagtgatgcgagattgttattg
agtgtattaaaatcaaaatcagttgaaaagatttttctacattttcctgttccttgggac
aaaaagcctcataggcgagttattgggaaagatttttgcaaagaatgtgctagggtttta
acccaaaatggtcgttttgaacttagaacagatagttttgagtattttaattttactcta
gaacaatttttgacttttcctgttccaaaatttagtcttagaaaaaatgaaaatttagaa
atttcaagcaaatatgaagatagatggaaaaagcaagaaaaaaatatatatgatctttgg
gtgtggaattttaaccaagagtgtaaaaactatgagttaaatgaatttaatctctcatcg
gttgaattttctaaagaggatttgaaaaaaatagagcagaactttaaaaatattactata
aaaaaagatgattttttcttgcattttgaaagcatctataaacaagatgagaatttgctt
ttaaaggttgcttttggagcttttaataagcctgaacattgttatttgcatcttgataaa
acgattgattttgcttttaaagagccatttaaaattcaagaaaatattaaagcgataaat
gaattaaaagaaattttaaaagttcagtttaaaatataa

DBGET integrated database retrieval system