KEGG   Campylobacter jejuni RM1221: CJE1540Help
Entry
CJE1540           CDS       T00227                                 

Gene name
pldA
Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cjr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:cjr00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:cjr00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1435658..1436647
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLSLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSEA
TQMQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGTNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYKHSSPFRETNYQPEFFIDLPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPENKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHNNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaagcttatgcgtttttatatgggctagtgatttacaa
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaataactcaagcgaagca
acacaaatgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagttttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggaacaaataataat
aagagtgaggcgaaatttcaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttataagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagatcttcctttatat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctactgctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaaacaaaaaa
gatgatgataatcctgccatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttaggtgatgattattttatcaatcttatgctaagaaataatcttaaattccacaataat
aaaggcgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttacaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system