KEGG   Campylobacter jejuni RM1221: CJE1540Help
Entry
CJE1540           CDS       T00227                                 

Gene name
pldA
Definition
phospholipase A (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
cjr  Campylobacter jejuni RM1221
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJE1540 (pldA)
   00565 Ether lipid metabolism
    CJE1540 (pldA)
   00590 Arachidonic acid metabolism
    CJE1540 (pldA)
   00591 Linoleic acid metabolism
    CJE1540 (pldA)
   00592 alpha-Linolenic acid metabolism
    CJE1540 (pldA)
Enzymes [BR:cjr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     CJE1540 (pldA)
    3.1.1.32  phospholipase A1
     CJE1540 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1435658..1436647
Genome map
AA seq 329 aa AA seqDB search
MRKIALFLSLCVFIWASDLQQALEYEKQGDYKKAMEIYKKLALKNSSVLISQEQNNSSEA
TQMQNSITIKKEEKQDFSRLALANYLGENESFNPLGISSYKMNYFLPFAYSFNSLGTNNN
KSEAKFQLSVKKRLFENLLGLDEKYYIAYTQTSWWQIYKHSSPFRETNYQPEFFIDLPLY
LKDYEFFNNLRVGILHESNGKGDENLQSRSWNRIYVSTAILYNKFLFVPRLWYRIPENKK
DDDNPAILHYMGNFDVNLAYLGDDYFINLMLRNNLKFHNNKGAIQVDLGYDIFNNGIYWY
LQYFNGYGESLIDYNKHLQRLSTGFLISY
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattgctttatttttaagcttatgcgtttttatatgggctagtgatttacaa
caagctttagagtatgaaaaacaaggcgattataaaaaagctatggaaatttacaaaaaa
ctcgctttaaaaaattcatctgttttgatttctcaagaacaaaataactcaagcgaagca
acacaaatgcaaaattctatcactataaaaaaagaagaaaaacaagacttttctcgctta
gctttggctaattatcttggtgaaaatgaaagttttaatccccttggcattagctcttat
aagatgaattattttttaccttttgcttatagttttaattctttaggaacaaataataat
aagagtgaggcgaaatttcaacttagtgttaaaaaaagactttttgaaaatttactagga
ctagatgaaaaatattatatagcctatactcaaacttcttggtggcaaatttataagcat
tcttctccttttagagaaaccaactatcaaccagaattttttatagatcttcctttatat
cttaaagattatgaattttttaacaatctacgcgtaggtatattgcatgaaagcaatggc
aagggagatgagaatttacaatctcgctcatggaatagaatttatgtatctactgctatt
ttatataataaatttttatttgttccacgcctttggtatagaattcctgaaaacaaaaaa
gatgatgataatcctgccatcttgcattatatgggaaattttgatgtgaatttagcgtat
ttaggtgatgattattttatcaatcttatgctaagaaataatcttaaattccacaataat
aaaggcgctatacaagttgatctaggatatgatatttttaataacggaatttattggtat
ttacaatactttaatggctatggagaaagccttatagactataacaaacacttacaaaga
ctttccactggatttttgatttcttactaa

DBGET integrated database retrieval system